Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005064001
Length(AA) : 629
Localization : scaffold_17
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_01537
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001597343.1| Score: 799 E_value: 6e-83
KEGG Definition: hypothetical protein
Accession: fgr:FG05937.1 Score: 724 E_value: 2e-74
KOG Definition: Phospholipase A2 (platelet-activating factor acetylhydrolase in humans)
Classification: [Lipid transport and metabolism].
Kog Number: KOG3847 Score: 323 E_value: 2e-30
PFAM Definition: PAF-AH_p_II, Platelet-activating factor acetylhydrolase, plasma/intracellular isoform II. Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipases A2, responsible for inactivation of platelet-activating factor through cleavage of an acetyl group. Three known PAF-AHs are the brain heterotrimeric PAF-AH Ib, whose catalytic beta and gamma subunits are aligned in pfam02266, the extracellular, plasma PAF-AH (pPAF-AH), and the intracellular PAF-AH isoform II (PAF-AH II). This family aligns pPAF-AH and PAF-AH II, whose similarity was previously noted..
Pfam Number: pfam03403 Score: 354 E_value: 5e-34
Swissprot: Q9URV1|PLG7_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.204NO0.516NO0.147NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1870.0470.763_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.07266First60=0.00019PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005064001
MSFLSRLNLIPQFPTYPGPYHVGSFELEIPASSLEPTSKRSPPDTKVETV
QFRVFYPAEKPDSANTTGWFGNTAKKSIRWLPEPYQREYLSGYARFMGVS
SRFAEIVSYLPRALYYISLPATANAQLLGGKPPEFRFPTMVFSHGLGGTR
LAYSHICGSIASYGVIVVAPEHRDGSGPVSFVKVPAMKGARVSGGKSEAG
KPDVNESSAKAPVKDTNGRIQVDYRAYPHQVSAETENGRNKQLEIRLWEL
SLIYSALSKIDIGKVPEDAIMSSDEGEINEGTMSPEAKNLLSTFKGNLDV
KDPGKLIWAGHSFGAATMIQFLKSVYYPPPTKPSINPLLALDASLPPNSF
DVLPLGKQITATSPLLLLDLWCLPLLGKRTSHLFKQPLPQISNKPNLVLV
IMSEEFFRWKENLRGVKRILSPEPGQKRGTPHHEIFEKWDEEDTGDARDT
AAHEDMSKHFHPNNDLLSPSISPAVGLSSTPDQGGQIIPPTATPSPTPER
QHKHQHHVVKNREPRFYYVRKSAHLSQSDFGILFPVVARHAENPRRILDL
NVRATIQWLREAGYSDRLAKTEHLEELVHGLHLNGDDMDKGEESKNREGD
WGIWEEGGTGAEGWGRIDLEETDIPEVKI

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig124 hypothetical protein SS1G_01537 [Sclerotinia sclerotiorum 1980]3e-22
SY0AAC14YO13FM1 hypothetical protein SS1G_01537 [Sclerotinia sclerotiorum 1980]1e-45


Manual Annotation:

Please find below the necessary files for GSTUMT00005064001 annotation :

link to GSTUMT00005064001 Artemis file
link to scaffold_17 sequence file
link to scaffold_17ESTs