Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005001001
Length(AA) : 565
Localization : scaffold_17
Number of EST contigs matching the gene: 4
Number of ESTs : 156
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An04g06250
Specie: [Aspergillus niger]
Accession: ref|XP_001401988.1| Score: 1287 E_value: 1e-139
KEGG Definition: hypothetical protein
Accession: ang:An04g06250 Score: 1287 E_value: 1e-140
KOG Definition: Predicted transporter (major facilitator superfamily)
Classification: [General function prediction only].
Kog Number: KOG0254 Score: 332 E_value: 2e-31
PFAM Definition: MFS_1, Major Facilitator Superfamily..
Pfam Number: pfam07690 Score: 346 E_value: 4e-33
Swissprot: Q00357|TOXA_COCCA
Gene Ontology:
GO:0016021 = Cellular component: integral to membrane
GO:0019534 = Molecular function: toxin transporter activity
GO:0006810 = Biological process: transport

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.096NO0.110NO0.061NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0520.2990.84_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=299.373First60=4.26878PredHel=14
Topology=(58-75,96-115,125-144,151-173,183-205,212-234,254-276,288-310,325-347,359-381,386-408,415-437,452-474,526-543)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005001001
MSLPSTTPSPGPEFNEKSLGVPERDVERGPSAATSSTGDLVLGDKSAEEV
PPRTVKGVLWVLVVISILSSTFLFALDNTVVADIQASVITDFGEIEKLSW
LGIAFVLAGCATILPWGKAYGVFNAKWLYILAVLIFEIGSAVCGAAPNMN
ALIVGRAVAGLGGSGMYLGSLNLLSVTTTVHERPAYIGTTGLTWGLGTVL
GPVVGGAFSESPATWRWAFYINLLIGALFAPVYLMLLPSADPQANTPFGS
RIKQLDWLGTILNIGSFVSLIMAINFGGTLYEWNSSQEITLFVVGGVLII
AFGVTQAYSVLTTPAQRLFPGEFLRDPFLVLLFAMMAAASTAIFVPTYYI
PLYFQFVRGDTALEAAVRLLPFIIIMVVFCIVNGGAMSKTGYYAPWYLFG
GAMVLIGGSLMYTVEETTSTTKIYGYTVLIGIGSGSYVQASFSVAQAKVK
PGQLASAVGYISLAQTGGIVIALAICGSVFLNESVKGITPFLEGVPTAAI
KGAVAGSGSELFMSLEGETRKNVLHAIIKAMDKNYILLIVAGAMTVIGSL
FMKWEKLFLEAGHAG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1422 hypothetical protein An04g06250 [Aspergillus niger]1e-139
SY0AAA20YG05FM1 hypothetical protein CIMG_02396 [Coccidioides immitis RS]5e-26
SY0AAA57YM20FM1 predicted protein [Aspergillus terreus NIH2624]9e-40
SY0AAB25YI14FM1 MFS drug efflux transporter [Aspergillus fumigatus Af293]8e-35


Manual Annotation:

Please find below the necessary files for GSTUMT00005001001 annotation :

link to GSTUMT00005001001 Artemis file
link to scaffold_17 sequence file
link to scaffold_17ESTs