Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004970001
Length(AA) : 110
Localization : scaffold_16
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_03320
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001595231.1| Score: 347 E_value: 1e-31
KEGG Definition: hypothetical protein
Accession: fgr:FG08725.1 Score: 314 E_value: 4e-28
KOG Definition: Cytochrome c oxidase assembly protein PET191
Classification: [Posttranslational modification
Kog Number: KOG4114 Score: 234 E_value: 3e-21
PFAM Definition: No Hit Found
Swissprot: Q02772|PT191_YEAST
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion
GO:0008535 = Biological process: respiratory chain complex IV assembly

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.126NO0.380NO0.101NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0930.1040.87_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00359First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004970001
MPSSCKDIRAALAQCLENSDCVMVDRNKPADCLRYPLVETLPTRCQRLKK
GYGECKRGMVDMRKRFRGNYPVALSVENEGGGGSRQLYGGGSALSDPPSG
TKAEGKEGGK

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB46YH09FM1 hypothetical protein SS1G_03320 [Sclerotinia sclerotiorum 1980]2e-31


Manual Annotation:

Please find below the necessary files for GSTUMT00004970001 annotation :

link to GSTUMT00004970001 Artemis file
link to scaffold_16 sequence file
link to scaffold_16ESTs