Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004940001
Length(AA) : 792
Localization : scaffold_16
Number of EST contigs matching the gene: 4
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_10758
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001588311.1| Score: 614 E_value: 2e-61
KEGG Definition: hypothetical protein
Accession: mgr:MGG_03232 Score: 520 E_value: 9e-51
KOG Definition: Leucine-rich repeat (LRR) protein
Classification: [
Kog Number: KOG0532 Score: 258 E_value: 1e-22
PFAM Definition: No Hit Found
Swissprot: O94294|SOG2_SCHPO
Gene Ontology:
GO:0000935 = Cellular component: barrier septum
GO:0051286 = Cellular component: cell tip
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.037NO0.104NO0.034NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3420.0360.728_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00542First60=0.0002PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004940001
MNGFEFSSYKTSTMRSDISTIYRPSPTSSLAGNVSSGNTPGYRQSPPVPI
DKTTCIALVTNALKEAREKNREAELRGRGNNSPDLSAQQQFYQRSGVTID
LSHQKISNIPLDVIELIKDEIERLALAHNQLTSFSEEFSSLPRLRYLNLR
SNFLREFPLPLTKLPSLEILDVSRNRLRSLPQDFGKLMSLKVLSMSKNKI
NVLPTYIGDMNELKILKLDHNPILFPAKDVLENGEADRDTWLETVKRFLK
NHAERSNPALDTESGSSSDEGGGDNDFSSLNSTVARTPSFESERPESSLS
TIRPLKLAGEATMPGFNGPQKGSLPRRPPQKQPTLSPSPALPTSTLTSPP
QSLINSGAGSSQTERSRSNSESTVQAHRGNRRMGMLGPRKTSNATAAEGL
RTVEEQKTLKHQRGYSHDSVIDSAQRSAQMGKPIDGSSRSPTDKERQPGP
YFRRLSSLPEHKRASLSSARVGEAARGILYAMSTLQRPIEQYVQSAGDPN
GGPHHKVERVLYNGNLHIGSLVGSLEAYEEKDDEAAVDNVVDACCACLAA
FKQVLNMVQSDSREIGAGMVGADARYMRTLLLMVYGSYVEIQSSYDIVKP
LIVGQASDSTLRSYNPGNLIARYPPNSNGNLRLKSASTASSTTSIATSVV
SISQSAAIPPVLPTPRGDIFAVPPTPGFQSNLSHSSDGGFDHDEPLYGKF
QAATAAALSTLPIIDREIKTAVTQNLQPSTTLKLREVSSLCATGAEAARR
LSKTKWDAIRDGDIIERRKFWEDTNKFTNVGSLFLKSLKPKY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3070 hypothetical protein SS1G_10758 [Sclerotinia sclerotiorum 1980]4e-10
SY0AAA27YH02FM1 No hit found
SY0AAA61YN02FM1 leucine-rich repeat protein SOG2 (predicted) [Schizosaccharomyces pombe 972h-]3e-24
SY0AAD31YD08FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00004940001 annotation :

link to GSTUMT00004940001 Artemis file
link to scaffold_16 sequence file
link to scaffold_16ESTs