Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004713001
Length(AA) : 149
Localization : scaffold_14
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : MANTUM00004713001  [+]

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE62753.1| Score: 745 E_value: 1e-77
KEGG Definition: ubiquitin-protein ligase [EC:6.3.2.19]; K10580 ubiquitin-conjugating enzyme E2 N
Accession: aor:AO090120000129 Score: 745 E_value: 5e-78
KOG Definition: Ubiquitin-protein ligase
Classification: [Posttranslational modification
Kog Number: KOG0417 Score: 600 E_value: 2e-63
PFAM Definition: UQ_con, Ubiquitin-conjugating enzyme. Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine..
Pfam Number: pfam00179 Score: 483 E_value: 8e-50
Swissprot: P35128|UBCD3_DROME
Gene Ontology:
GO:0007412 = Biological process: axon target recognition
GO:0007629 = Biological process: flight behavior
GO:0007625 = Biological process: grooming behavior
GO:0007630 = Biological process: jump response
GO:0008594 = Biological process: photoreceptor cell morphogenesis

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.049NO0.160NO0.056NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1290.0540.857_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00907First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004713001
MALPKRIIKETERLVAEPVPGINAVPHEDNLRYFDVTIHGPTQSPYEGGI
FRLELFLPEDYPMTPPKIRFLTKIYHPNIDKLGRICLDVLKGNWSPALQI
RTILLSIQALLGAPNPDDPLANDVAQRWKEDERAAIETAREWTMTHARV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig167 unnamed protein product [Aspergillus oryzae]5e-73
Contig4693 unnamed protein product [Aspergillus oryzae]3e-72


Manual Annotation:

Please find below the necessary files for GSTUMT00004713001 annotation :

link to GSTUMT00004713001 Artemis file
link to scaffold_14 sequence file
link to scaffold_14ESTs