Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004657001
Length(AA) : 468
Localization : scaffold_14
Number of EST contigs matching the gene: 2
Number of ESTs : 39
  User annotation : Tmelcs1  [+]

Blast Results:

Nr Definition: hypothetical protein SNOG_07690
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001798022.1| Score: 1776 E_value: 0.0
KEGG Definition: conserved hypothetical protein [EC:2.3.3.1]; K01647 citrate synthase
Accession: mgr:MGG_02617 Score: 1758 E_value: 0.0
KOG Definition: Citrate synthase
Classification: [Energy production and conversion].
Kog Number: KOG2617 Score: 1327 E_value: 1e-147
PFAM Definition: Citrate_synt, Citrate synthase..
Pfam Number: pfam00285 Score: 991 E_value: 1e-108
Swissprot: Q9TEM3|PRPC_EMENI
Gene Ontology:
GO:0005759 = Cellular component: mitochondrial matrix
GO:0050440 = Molecular function: 2-methylcitrate synthase activity
GO:0019679 = Biological process: propionate metabolic process
methylcitrate cycle

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.210NO0.422NO0.216NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8520.0250.195M226

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.02845First60=0.00839PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004657001
MSTRALSCNLGGIASRIRLVYAGQRNASTLAQKDLKDTLKEIIPAKREAL
KRLKAEHGQKVLGEVKVENAIGGMRGIKGMLWEGSVLDANEGIRFHGKTI
KDCQKVLPKGTFGEEMLPEGMFWLLLTGQVPSVEQVRGLSRTLAENAGLP
DFVGLMLDNMPTTLHPMTQFAIAVSALNHNSKFAKLYEKGLSKADYWEPT
FDDSISLLAKLPTIAAKIYQNTYLGGGPLPSPVATQDWSYNYAAMLGKSD
NTGFVDLLRLYLALHGDHEGGNVSAHATHLVGSALSDPFLSYSAGLQGLA
GPLHGLAAQEVLRFIQAMRKVVGDTYSDKDIENYLWSLLNSGQVIPGYGH
AVLRKPDPRFEALMGFAESRPEVAEGAVFKLVKKNSEIAPRVLTEHGKTK
NPHPNVDSASGVLFHHYGINQDLYYTVTFGVSRGLGPLAQLIWDRALGLP
IERPKSLSMEAISKAIGA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3928 hypothetical protein SNOG_07690 [Phaeosphaeria nodorum SN15]0.0
Contig6490 hypothetical protein SNOG_07690 [Phaeosphaeria nodorum SN15]0.0


Manual Annotation:

Please find below the necessary files for GSTUMT00004657001 annotation :

link to GSTUMT00004657001 Artemis file
link to scaffold_14 sequence file
link to scaffold_14ESTs