Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004586001
Length(AA) : 604
Localization : scaffold_13
Number of EST contigs matching the gene: 2
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: ABC transporter, putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001260862.1| Score: 1655 E_value: 0.0
KEGG Definition: CaO19.10632; hypothetical protein
Accession: cal:CaO19_10632 Score: 1653 E_value: 0.0
KOG Definition: Transporter
Classification: [
Kog Number: KOG0061 Score: 1118 E_value: 1e-122
PFAM Definition: ABC2_membrane, ABC-2 type transporter..
Pfam Number: pfam01061 Score: 331 E_value: 2e-31
Swissprot: Q8RXN0|WBC11_ARATH

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.022NO0.046NO0.028NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0460.1070.936_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=134.153First60=0.00235PredHel=6
Topology=(336-358,367-389,409-431,444-466,472-494,568-590)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004586001
MSDNIDLEALPKGGGKEISQFSWKGLTVTVKDSKTKEALDILKDVEGCAQ
PGDMVALMGPSGSGKTTLLNVLARRPVAASASVKGQVHLDNAPLQAKALR
EISTYVEQEDALIGSLTVQETIEFAARLSGAERHAGRVSELIRAFGLAKQ
AHTKIGTPVAKGISGGQKRRVSIASQLITRPKILFLDEPTSGLDSKAAYE
VMYRIQQVARDENMIVIASIHQPTTATFNLFSQLVLLSAGKLVYSGPVDQ
VVPYFSTQGVPIPPLTNPAEFLLDVCNTDFDNSATDVGGEESRIARLNRL
MEAWSPKSSATEISSTPFADFEGALMLLQRLWLKSYRDLLAYWIRVIMYL
GLAFMMGTVWLRLGRGQDNIQPFINAIFFSGAFMSFMAVAYIPAYLEDHE
SFRKERANGLYGPTAFLLSNFLIGIPFIFLIAVLFSLVTVFLCNFRQTPE
HFFRYVMWLFLDLLAAESLVVLISSLIPVFVAALAITAFANGLWMSVGGF
LVSPKVLNDFWYYTFYWIDYQRYVFQGMMFNEFDGRVYNCAKVGDECQCM
YPSGLADQCNIEGRGVLTALGYGKKDIGLWIGVLIAVTFGMRGLAWITLK
VKRN

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1061 hypothetical protein SNOG_09117 [Phaeosphaeria nodorum SN15]2e-51
Contig2705 hypothetical protein DEHA0C04334g [Debaryomyces hansenii CBS767]1e-105


Manual Annotation:

Please find below the necessary files for GSTUMT00004586001 annotation :

link to GSTUMT00004586001 Artemis file
link to scaffold_13 sequence file
link to scaffold_13ESTs