Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004552001
Length(AA) : 492
Localization : scaffold_13
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: mitochondrial chaperone BCS1, putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001263165.1| Score: 1181 E_value: 1e-127
KEGG Definition: mitochondrial chaperone BCS1, putative; K08900 mitochondrial chaperone BCS1
Accession: afm:AFUA_3G13000 Score: 1178 E_value: 1e-127
KOG Definition: AAA+-type ATPase
Classification: [Posttranslational modification
Kog Number: KOG0743 Score: 800 E_value: 7e-86
PFAM Definition: BCS1_N, BCS1 N terminal. This domain is found at the N terminal of the mitochondrial ATPase BSC1. It encodes the import and intramitochondrial sorting for the protein..
Pfam Number: pfam08740 Score: 465 E_value: 5e-47
Swissprot: P32839|BCS1_YEAST
Gene Ontology:
GO:0005743 = Cellular component: mitochondrial inner membrane
GO:0009060 = Biological process: aerobic respiration
GO:0051131 = Biological process: chaperone-mediated protein complex assembly
GO:0007005 = Biological process: mitochondrion organization and biogenesis

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.036NO0.147NO0.045NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0740.1640.855_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.19841First60=0.1422PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004552001
MNIGSLLPKPPGKGVGDNRGGDSSTGSAVDASGGDGGLVGQLSSNPLFTG
GVGIILLTAAAQLARKSLTSLSTHLRNQMLVTLEIPSTDKSYDWFLHWMS
QNSSSSSSPRSTSKSLLEWMTTFRPAPRHLAVETKYIRHASGGISTDFTL
LPGTGRHLLNFRGNFLRVNRERDAKRVDLQRGTPWELITITTLFASRSVF
PALLQEARDLAVKLEEGKTIIYTSWSTEWKPFGRPRRKRPLSSVVLKPGL
SQELLTDVKSFLNSARWYYDRGIPYRRGYLLYGPPGTGKSSFVQALAGEL
DYGICLLNLSERGLTDDRLNHLLSNMPERSIALLEDVDAAFGRGRAVTEE
DGYRGANVTFSGLLNALDGVASSEERIVVMTTNYPERLDEALVRPGRVDV
KAEIGYAGREEVEVMWERFYGGESVDGVVGEEELARRGKLREVFVERLEA
AGAFEGRWGVSAASLQGLFVYFKGKPERAVENVGSLVPEGFR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig131 hypothetical protein CIMG_03460 [Coccidioides immitis RS]5e-79
SY0AAB60YB13FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00004552001 annotation :

link to GSTUMT00004552001 Artemis file
link to scaffold_13 sequence file
link to scaffold_13ESTs