Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004528001
Length(AA) : 608
Localization : scaffold_13
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein HCAG_06631
Specie: [Ajellomyces capsulatus NAm1]
Accession: ref|XP_001539026.1| Score: 916 E_value: 2e-96
KEGG Definition: hypothetical protein
Accession: fgr:FG03996.1 Score: 848 E_value: 6e-89
KOG Definition: Kinesin-like protein
Classification: [Cytoskeleton].
Kog Number: KOG0247 Score: 662 E_value: 1e-69
PFAM Definition: Kinesin, Kinesin motor domain..
Pfam Number: pfam00225 Score: 406 E_value: 5e-40
Swissprot: Q02241|KIF23_HUMAN
Gene Ontology:
GO:0005871 = Cellular component: kinesin complex
GO:0005819 = Cellular component: spindle
GO:0003777 = Molecular function: microtubule motor activity
GO:0005515 = Molecular function: protein binding
GO:0000022 = Biological process: mitotic spindle elongation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.161NO0.437NO0.138NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6920.0620.29M343

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00027First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004528001
MESAKSPPPSTAQLFQVFLRLRPSSPQSSVSETRFLTSAPSQNFVYVTPP
QERNRFRAIEKFGFTSIFDELSEQKDVFVETVMPLLQQAINGRDGTLATL
GVTGSGKTHTILGSKDQKGMTQMALDVLFSSIGDRVVDYDRVDIMGSDHT
EAILMDAVTFHERMNSALVKTPTKRPKPGNFLAHRLQDGHTSKRSSLAHI
STPKAPDVSDLSVDLDSKSKYAVLISMYELYNDRIFDLLDDLSINKQNRR
KALIFKKPSTTAAWDTSKESKKVVSGLRKVYTKNFQEALQILEHGQASRR
ASPTHSNSVSSRSHAFLQVEVKRFSPRGNEKGGASLHIVDLAGSERARTA
KTAGERLAEAGSINRSLMCLGQCLQLQTQVSDNGKPAVVPWRQSKLTELL
FSNSFSGAGGGGQRASMIVTADAMGDFNATTQILRYSALAREVTVPRASS
RQISGMSDSSAASSTLDELAAIPTSVTQDDSKDILIARLIAQLEETEARW
RDAEERCLSTEQQVREEVADEMEERLEEWREGYVDGKLEILRKGIKIRED
TPPGAAERIRELEGENEALRRESLVLRREALGRSPSKGRSGGRGFPSPLK
GMENLEIY

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB28YO12FM1 hypothetical protein CIMG_03455 [Coccidioides immitis RS]2e-30


Manual Annotation:

Please find below the necessary files for GSTUMT00004528001 annotation :

link to GSTUMT00004528001 Artemis file
link to scaffold_13 sequence file
link to scaffold_13ESTs