Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004492001
Length(AA) : 416
Localization : scaffold_12
Number of EST contigs matching the gene: 3
Number of ESTs : 28
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_00074
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001597988.1| Score: 441 E_value: 1e-41
KEGG Definition: cellobiose dehydrogenase, putative
Accession: afm:AFUA_8G05805 Score: 426 E_value: 3e-40
KOG Definition: Predicted membrane protein
Classification: [
Kog Number: KOG4293 Score: 165 E_value: 3e-12
PFAM Definition: No Hit Found
Swissprot: Q01738|CDH_PHACH
Gene Ontology:
GO:0047735 = Molecular function: cellobiose dehydrogenase (acceptor) activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.762YES0.978YES0.726YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1970.760.044S323

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=114.271First60=1.37821PredHel=5
Topology=(242-264,276-298,313-332,345-367,377-399)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004492001
MVSFKSFLATAVISAATLTYAQSSSPVQGFTDRSSTFVANWNLPASGDDV
FLHIRGPTSAGWIATGIGSAMSGSLMFIIYQNGEGNVTFSPRLGTGEVEP
KFESSIQFELLEGTGVQGELMTANIKCSNCRTWDGGSLAVTSTNQNFIWA
IGDQTVTSKSQTETLSKHVRNGFYRLDMTQVTGGDSPNPFVSGDSASGTA
SGGAEATGSSSSSGSSSGRGASASATGGSGGSSTSFSPPMTKGDKVLIAH
GVIMGVVFILLFPFGAALVRLLNNRIPNAFALHRGLQILNFMLAVVGMGM
GIWRSKISNSHYKFFHQYFGTIIIALLLVQAMLGQLHHNVYLKTQKRSLW
SYAHIWHGRFVIVAGIVNGGIGLSLPRTDAPQSAVVAYSVVAGVVGVGYL
VFYFLKERRKEVGVSP

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1734 hypothetical protein SNOG_02248 [Phaeosphaeria nodorum SN15]2e-18
Contig1763 conserved hypothetical protein [Aspergillus clavatus NRRL 1]1e-30
SY0AAD58YA11FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00004492001 annotation :

link to GSTUMT00004492001 Artemis file
link to scaffold_12 sequence file
link to scaffold_12ESTs