Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004475001
Length(AA) : 288
Localization : scaffold_12
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein MGG_12868
Specie: [Magnaporthe grisea 70-15]
Accession: ref|XP_001409060.1| Score: 917 E_value: 4e-97
KEGG Definition: hypothetical protein [EC:4.2.1.17]; K01692 enoyl-CoA hydratase
Accession: mgr:MGG_12868 Score: 917 E_value: 2e-97
KOG Definition: Enoyl-CoA hydratase
Classification: [Lipid transport and metabolism].
Kog Number: KOG1680 Score: 711 E_value: 8e-76
PFAM Definition: ECH, Enoyl-CoA hydratase/isomerase family. This family contains a diverse set of enzymes including: Enoyl-CoA hydratase. Napthoate synthase. Carnitate racemase. 3-hydoxybutyryl-CoA dehydratase. Dodecanoyl-CoA delta-isomerase..
Pfam Number: pfam00378 Score: 523 E_value: 6e-54
Swissprot: Q52995|ECHH_RHIME
Gene Ontology:
GO:0004300 = Molecular function: enoyl-CoA hydratase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.616YES0.739NO0.384NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.9040.0580.06M190

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01976First60=0.00017PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004475001
MFARFIRPTPARLISPIVPRLVHPMSSLSSKSYEHILVSSPRPGVGQVTL
NRPKVNALNTPLMSELNDALRAFDDSKAIGAIIITGSERAFAAGADIKEM
QNLTFSEAYSKDFIRLWSDVTQISKPVIAAVNGHALGGGCELAMMADIIY
CGPTATFGQPEITLGVIPGAGGSQRLVRAIGKARAMELILTGKTFSAEEA
ERWGLVARVFETPEKCVEGALETAETIAGYGALAVKAAKEVVNQSFEVGL
SEGVKYERRVFHALFSTKDQKTGMTAFVNRTKPEWAGE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1733 hypothetical protein BC1G_00915 [Botryotinia fuckeliana B05.10]9e-71


Manual Annotation:

Please find below the necessary files for GSTUMT00004475001 annotation :

link to GSTUMT00004475001 Artemis file
link to scaffold_12 sequence file
link to scaffold_12ESTs