Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004439001
Length(AA) : 902
Localization : scaffold_12
Number of EST contigs matching the gene: 2
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: protein kinase Yak1, putative
Specie: [Neosartorya fischeri NRRL 181]
Accession: ref|XP_001262420.1| Score: 2014 E_value: 0.0
KEGG Definition: protein kinase Yak1, putative [EC:2.7.12.1]; K08825 dual-specificity tyrosine-(Y)-phosphorylation regulated kinase
Accession: afm:AFUA_4G03850 Score: 2014 E_value: 0.0
KOG Definition: Dual-specificity tyrosine-phosphorylation regulated kinase
Classification: [General function prediction only].
Kog Number: KOG0667 Score: 1311 E_value: 1e-145
PFAM Definition: Pkinase, Protein kinase domain..
Pfam Number: pfam00069 Score: 458 E_value: 7e-46
Swissprot: P14680|YAK1_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0005515 = Molecular function: protein binding
GO:0004672 = Molecular function: protein kinase activity
GO:0006468 = Biological process: protein amino acid phosphorylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.037NO0.095NO0.047NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2960.030.8_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.31254First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004439001
MDPWPSYSTDSTANRQPRYANNVLQQNPSPQHLRDHNPPQQPPPSSMAAA
SGPGTTQQPYQAYHGTGAGPPPAQPAPTTRLDSASDYMDVQMPDADSYGR
AKYQQPQSSRQPYVSPEEPASQRYTGIGSNSNPQAGYGSSASTHSLPQVN
YPPQMATSTSSSSYQQRQSPSRLNYTSSSQSYYAQQQQPPAASPRTSAPP
SMQSYQHHLQQSGSGSSGSDPNNGRYFSSSGSSMPQGSMYDQMHIGHHQS
APREHPPRFSRVAALSDLKPQTNSQPAFRRAHPEGGFISPLQALTTHLPS
TYRICNPTFKYESSRNPRRVLTKPSKGVKNDGYDNEDSDYILYVNDILGS
EETKNRYLILDVLGQGTFGQVVKCQNLKTQEVVAVKVVKNRTAYFNQSMM
EVSVLDLLNSKLDKNDDHHILRLKDTFIHRQHLCLVFELLSVNLYELIKQ
NQFRGLSTTLVRVFAQQLLNALCLLNKARLIHCDLKPENILLKNLESPII
KVIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSSIDMWSLGCIVVE
LFLGLPLFPGSSEYNQVARINEMLGMPPVWMLEMGKQAGEFFEKVHDEFG
RKIYQLKSMEKYSREHGTKEQPSKKYFQATTLPEIIRQYAMPRKNMKPIE
IEREMNNRIAFIDFVRGLLNINPVERWSPQQAKLHPFITQQKYTGPFVPP
MNLKSPPPKSPMSGAEQQRAEQAMMQKQQAAMQAQAQIQAQQRAQQAQQA
AHVAQSQPNYSAVSLGNFPASSGHPQPPTVYNNAYSSTQQPNQPQQQAPP
AYTTSTLYSQNPNRAARQRSATMVDGVPPQIQRAASMMDPTQPIRLQPSP
AYFPPPPGGIPDEPGNGRGRQQARGGQYRNRNVIRTLEGNLEDGLLSQQH
WG

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4588 hypothetical protein HCAG_08703 [Ajellomyces capsulatus NAm1]2e-96
Contig7409 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00004439001 annotation :

link to GSTUMT00004439001 Artemis file
link to scaffold_12 sequence file
link to scaffold_12ESTs