Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004429001
Length(AA) : 290
Localization : scaffold_12
Number of EST contigs matching the gene: 4
Number of ESTs : 13
  User annotation : No user annotation

Blast Results:

Nr Definition: nitrilase
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001547310.1| Score: 668 E_value: 3e-68
KEGG Definition: hydrolase, carbon-nitrogen family, putative
Accession: afm:AFUA_5G02350 Score: 648 E_value: 3e-66
KOG Definition: Carbon-nitrogen hydrolase
Classification: [Amino acid transport and metabolism].
Kog Number: KOG0807 Score: 277 E_value: 2e-25
PFAM Definition: CN_hydrolase, Carbon-nitrogen hydrolase. This family contains hydrolases that break carbon-nitrogen bonds. The family includes: Nitrilase EC:3.5.5.1, Aliphatic amidase EC:3.5.1.4, Biotidinase EC:3.5.1.12, Beta-ureidopropionase EC:3.5.1.6. Nitrilase-related proteins generally have a conserved E-K-C catalytic triad, and are multimeric alpha-beta-beta-alpha sandwich proteins..
Pfam Number: pfam00795 Score: 321 E_value: 1e-30
Swissprot: Q9NQR4|NIT2_HUMAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.065NO0.395NO0.053NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1490.0570.826_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.10367First60=0.00033PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004429001
MSEIPSKWKCAVIQLHSKPMQLEDNFNRAQGFIRKAAEAGARLAVLPEYS
LTSWVPDDPGFADAHVDREYLSKFCELAKECNINIVPGTFVERHVDDGKD
MLYNVAHFISNEGKILGSYTKKNLWHTERAHLEAAGNNPHTVMDTPLGKV
GLLICWDLAFPEAFRALIIQGAKIIIIPSFWNLLDLTEPAFQRNPRSEAI
YLESIVISRAFENVSCIAFANVGGQKESGFAGLSQIAMPLMGDIARAEGA
HEQMVIGEVDMEVLQDAEESYKVREDISRPDFHYPVYAKN

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig136 nitrilase [Botryotinia fuckeliana B05.10]2e-61
SY0AAA20YD02FM1 nitrilase [Botryotinia fuckeliana B05.10]2e-21
SY0AAD22YD11FM1 nitrilase [Botryotinia fuckeliana B05.10]5e-39
SY0AAD48YI13FM1 nitrilase [Botryotinia fuckeliana B05.10]3e-26


Manual Annotation:

Please find below the necessary files for GSTUMT00004429001 annotation :

link to GSTUMT00004429001 Artemis file
link to scaffold_12 sequence file
link to scaffold_12ESTs