Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004391001
Length(AA) : 537
Localization : scaffold_11
Number of EST contigs matching the gene: 10
Number of ESTs : 291
  User annotation : No user annotation

Blast Results:

Nr Definition: flavin-binding monooxygenase, putative
Specie: [Aspergillus fumigatus A1163]
Accession: gb|EDP55403.1| Score: 1429 E_value: 1e-156
KEGG Definition: flavin-binding monooxygenase, putative
Accession: afm:AFUA_6G13790 Score: 1426 E_value: 1e-156
KOG Definition: Flavin-containing monooxygenase
Classification: [Secondary metabolites biosynthesis
Kog Number: KOG1399 Score: 194 E_value: 2e-15
PFAM Definition: FMO-like, Flavin-binding monooxygenase-like. This family includes FMO proteins and cyclohexanone monooxygenase..
Pfam Number: pfam00743 Score: 184 E_value: 2e-14
Swissprot: Q00730|STCW_EMENI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.249NO0.465NO0.158NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6540.0520.319M497

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01566First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004391001
MSMISTLRAPPTHQTGFQLWRNPYAPRNENQFKYGDFMDHIIYEKNHDIG
GTWLENRYPGVACDVPAHIYTFSWEPNPDWSEFYVGGEEIFQYMKRTTAK
YDLARDVVFNSKVVEAIWDQGRGKWELKIEQEGRFIWDECDIFINASGIL
NKWKLPSIEGINAFKGHLVHSAKWEDTYDFAGKRVGIIGNGSSALQIVPK
LQEVAGHLVNFMRTPTWISATYSSELLPDGKNFYYTEEQKSEFRNNPKLL
NEYRKKIESGFNKFFYALLNDSPAQAAITEQYTQIMSERLGNDPELIKKF
IPSWRVGCRRLSPGEGYLEALQAPNAKYTWDPIERITEKGVVTSAGEIEL
DAIVCATGFDVSFMPQWKMRGLNGSTLDKWRDDPEGYLGIFAPSMPNYFI
VNGPNCPVGHGSLLSVMEWTTEYIIRWAKKIASENIKAVMVKPNVVREWN
VYAQEYLKRTVWTSGCRSWYKNGKIEGKVTATYPGSVIHYKEVLETIRGE
DFNIEYSEPRNRFGFMGNGFTALEMDEDADLAFYMYK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4011 flavin-binding monooxygenase, putative [Aspergillus fumigatus A1163]1e-163
Contig4460 unnamed protein product [Aspergillus oryzae]1e-46
Contig4540 conserved hypothetical protein [Aspergillus terreus NIH2624]6e-60
Contig5461 conserved hypothetical protein [Aspergillus terreus NIH2624]3e-62
Contig5604 unnamed protein product [Aspergillus oryzae]2e-50
Contig6115 hypothetical protein An11g08030 [Aspergillus niger]2e-78
Contig7139 conserved hypothetical protein [Aspergillus terreus NIH2624]7e-69
SY0AAD11YJ24FM1 conserved hypothetical protein [Aspergillus terreus NIH2624]8e-37
SY0AAD27YM24FM1 conserved hypothetical protein [Aspergillus terreus NIH2624]5e-55
SY0AAD46YH10FM1 conserved hypothetical protein [Aspergillus terreus NIH2624]5e-48


Manual Annotation:

Please find below the necessary files for GSTUMT00004391001 annotation :

link to GSTUMT00004391001 Artemis file
link to scaffold_11 sequence file
link to scaffold_11ESTs