Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004370001
Length(AA) : 296
Localization : scaffold_11
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CHGG_04161
Specie: [Chaetomium globosum CBS 148.51]
Accession: ref|XP_001223375.1| Score: 743 E_value: 7e-77
KEGG Definition: 3-hydroxyisobutyrate dehydrogenase [Neurospora crassa OR74A] )
Accession: ncr:NCU06559.1 Score: 733 E_value: 5e-76
KOG Definition: Predicted dehydrogenase
Classification: [General function prediction only].
Kog Number: KOG0409 Score: 540 E_value: 6e-56
PFAM Definition: NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase. The NAD binding domain of 6-phosphogluconate dehydrogenase adopts a Rossman fold..
Pfam Number: pfam03446 Score: 336 E_value: 3e-32
Swissprot: Q2HJD7|3HIDH_BOVIN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.140NO0.397NO0.110NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2620.0970.619_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.56164First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004370001
MGYPMARNLRVKASADDMLVIFDVNKDATTQFVDELGLTSKKIVVAGKLE
EVVDRSDTIITMLPQPQHVKTVFSSFLNVSSSPAGKEQKLFIDCSTIDIS
TSLSVGKSVCESALNGQFVDAPVSGGTVGAAAGTLTFMVGSEPALLPRIM
SLLSRMGSRVIHCGPPGAGLAGKLSNNYLLSITNIATAEAMNLGIKLGLD
SKVLKDLINVSSGRCWSSEVNNPVDTAQREFKGGFGVSLMKKDLKLAIQA
AEETGAKLAMGEKAKEVYEAVEGVEECKGRDFSVVYRWLGGEEGKM

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB23YB19FM1 3-hydroxyisobutyrate dehydrogenase [Aspergillus fumigatus A1163]3e-39


Manual Annotation:

Please find below the necessary files for GSTUMT00004370001 annotation :

link to GSTUMT00004370001 Artemis file
link to scaffold_11 sequence file
link to scaffold_11ESTs