Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004360001
Length(AA) : 685
Localization : scaffold_11
Number of EST contigs matching the gene: 2
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_08469
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001590729.1| Score: 1754 E_value: 0.0
KEGG Definition: nucleoside diphosphatase (Ynd1), putative [EC:3.6.1.5]; K01510 apyrase
Accession: afm:AFUA_5G11010 Score: 1695 E_value: 0.0
KOG Definition: Nucleoside phosphatase
Classification: [Nucleotide transport and metabolism].
Kog Number: KOG1386 Score: 852 E_value: 1e-91
PFAM Definition: GDA1_CD39, GDA1/CD39 (nucleoside phosphatase) family..
Pfam Number: pfam01150 Score: 710 E_value: 3e-75
Swissprot: P40009|YND1_YEAST
Gene Ontology:
GO:0005794 = Cellular component: Golgi apparatus
GO:0016020 = Cellular component: membrane
GO:0005792 = Cellular component: microsome
GO:0017110 = Molecular function: nucleoside-diphosphatase activity
GO:0017111 = Molecular function: nucleoside-triphosphatase activity
GO:0006486 = Biological process: protein amino acid glycosylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.029NO0.075NO0.028NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0790.0770.903_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=19.4377First60=0.00057PredHel=1
Topology=(536-555)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004360001
MPEKYGVILDAGSSGTRIHIYSWEDPVETRRKGRKDELRRLPRINTNKKW
AKKINPGISTFGEHPERVGEDHLNGLFEHALSQIPKDAIAHTPLFLLATA
GMRLLPDLERKTLLDEICTYARRTTQFLLPDCGLHIQVIAGETEGLYGWI
SANYLLGGFDDPETHAHGKGHHTYGFLDMGGASAQIAFAPNATEAEKHAD
DLVLLKMRNLNGDPMDYKVFVTTWLGFGVNQARGRYIDTLVEASSGGGVI
ELPDPCLPKGLRSTLDGKKIDSDYVPDEKAHLIGTGKFEECLRQTYPLLE
KDHLPCKEVSCLLKEGHAPAIDFDINHFVGVSEYWHTTHEIFETEHDAKA
YDFATYQQRVKEFCSQDWDTIEELVEKKKWGKRVDEEKAMQTCFKASWLI
NVLHNGIGIPRVGLETSGNSNHNGTEEVIEAAKSKGFLDPFQPVDKIADV
EVSWTLGKMVLYAASQIPPRDGGVNAVGFGKNVIGDNGLPNDFEYAAPQR
ASHHPDNSGMSGGSGGSNFSMDGSSDQAHWHDSLWKEGDKTPRRIPGLLL
FLLIFCLAGFLLMGRERRGRFWRAVKISGRRGKRKVLGSHGVVMYERIME
EGHNQFTDFELGSVSSSSSSDDETGGWRAKGSLYDPPIGGTGVDAVRSGL
GTRVGSRERLPMTTRGGDISPRGGSARARSPMPPR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4219 hypothetical protein SS1G_08469 [Sclerotinia sclerotiorum 1980]3e-97
Contig4315 hypothetical protein CIMG_00679 [Coccidioides immitis RS]3e-73


Manual Annotation:

Please find below the necessary files for GSTUMT00004360001 annotation :

link to GSTUMT00004360001 Artemis file
link to scaffold_11 sequence file
link to scaffold_11ESTs