Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004324001
Length(AA) : 1332
Localization : scaffold_11
Number of EST contigs matching the gene: 4
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_07082
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001797436.1| Score: 734 E_value: 5e-75
KEGG Definition: inositol hexaphosphate kinase KCS1, putative
Accession: afm:AFUA_5G13240 Score: 642 E_value: 1e-64
KOG Definition: Inositol polyphosphate multikinase
Classification: [
Kog Number: KOG1620 Score: 485 E_value: 7e-49
PFAM Definition: IPK, Inositol polyphosphate kinase. ArgRIII has has been demonstrated to be an inositol polyphosphate kinase..
Pfam Number: pfam03770 Score: 377 E_value: 3e-36
Swissprot: O74561|YCZ8_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.064NO0.168NO0.057NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1710.0490.814_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01252First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004324001
MPVPFHDPIPLKDSPLAPSGPVRSRTFPILTSSSFTADSGEEHKTISSHF
DTSPSFDDTLSVSQTSTSSSTTLSPSASSPSLVESTGVGPSEPIYGNSYD
EADLSRPLFRYWRPQSTSFPLEAKFTLGGGIHPDTRIAHSHKDGCIFSCR
QKEKNPHITLPPYISPADSPTDRPSTPLTGTSILKPTDGAGSDAILKAQL
GLDSPIDFNERLGTSVARWGAKNDADGEASFPIQSSPIREDEDDVGRSIA
AVMASESNSRSRKATQRLGLFRENEQAIEERGREKLRREEKEKEKERERQ
EKLRAKEKERKERLKGNGKMVSVAQLSKTIKENNAPPLDLSSNVLSVKST
KDAYSQSSSDELSSKVSDKTSIPTSYSNPVCGAVDGNESSGIQSTINSRL
DSAPKSISPTNGDSSSVCVGSDDSSPSSITTVVPEGHTEYPFPGCRDLSI
EVPDGFEPVERPDHPEDDDDEEEESDKDEISSALYIPHPTPNRAATDSSI
GHKAGPVKGQYSNSASQRSLIEADKQKNDDTRHKDHEESPEFDLSIQSGD
DEYIYQGRRQSVIADDDYKGYHSNTEGYSSAASGFSDFSDSYDELSSGEN
DRSGSGYGTALSETEDTTPTATPIARRPHIKYDQTLGNRKQHSSSAQSKA
VPQVPLGAVELKPYNHQVGGHTALFRFSRRAVCKSLSNKENEFYEAVEKR
HPQLLGFLPKYIGVLNVTFRRAPKKKKTIKKEAATGSPEVSGLATESEVF
VRSGKNCADSQPTETEFTKAPNVVYNSEATSGGAPFPLPQVVFENNRHII
PENLFRFSASAPSYSSNPACSASDKEGRSPEPTQGKGQKSTEAVSDTPEA
NATGSGDEIIQGEAHPRKSIWGATSVNRKLQEQVLREVFGSPSIPRGHHH
TRSHSRPRHYNCNHSHGHRHHHGSPPGADSRGCRSSFRRSSTDLGPSHRH
QAFPEDRKITSVRIEGERRHASSTDLRTLSKSNDITGGARSCLSRSPTTP
ERRRAGFPRRRSSGNICKRSGKPESLSPPICDYAAEDEVPSTASESTSQT
QQPQPIPSPLSIPPATESPDPVAINETPNIPIPKEVLQQPIERVEHFLLL
EDLTAGMKRPCVLDLKMGTRQYGVEASKKKKQSQANKCALTTSRDLGVRL
CGMQVWNVKEQTYLFQDKYFGRDLKAGREFQTALIRFLYDGKTNSSVLRH
IPTILEKLRALEAMIRGLPGYRFYASSLLMIYDGMDHDRNIDLKIVDFAN
CVTAEDPLPKVTTCPPKDRDGVDRGYLRGLRTLQKYIQSIWRETKGEGWV
ERGEEGGHGGGHQRDDIGPDWDLIEDLGEVST

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1415 inositol hexaphosphate kinase KCS1, putative [Neosartorya fischeri NRRL 181]2e-32
Contig2487 No hit found
Contig3020 No hit found
SY0AAA58YI22FM1 hypothetical protein NCU03546 [Neurospora crassa OR74A]3e-15


Manual Annotation:

Please find below the necessary files for GSTUMT00004324001 annotation :

link to GSTUMT00004324001 Artemis file
link to scaffold_11 sequence file
link to scaffold_11ESTs