Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004303001
Length(AA) : 396
Localization : scaffold_11
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein FG01856.1
Specie: [Gibberella zeae PH-1]
Accession: ref|XP_382032.1| Score: 854 E_value: 1e-89
KEGG Definition: hypothetical protein
Accession: fgr:FG01856.1 Score: 854 E_value: 7e-90
KOG Definition: Putative trehalase
Classification: [Carbohydrate transport and metabolism].
Kog Number: KOG2798 Score: 729 E_value: 1e-77
PFAM Definition: N2227, N2227-like protein. This family features sequences that are similar to a region of hypothetical yeast gene product N2227. This is thought to be expressed during meiosis and may be involved in the defence response to stressful conditions..
Pfam Number: pfam07942 Score: 774 E_value: 7e-83
Swissprot: Q8N4J0|CI041_HUMAN

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.048NO0.282NO0.073NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0870.0510.937_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01469First60=0.00056PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004303001
MSTNHVDPDPEFDSHGDAEELKALTSALSSFHLYRRAAHQNLTHCRRISF
FALSSTHQALLKQPPINYLRTLDIVDRAIEDNAVLSEAIFRSAVDAFGVD
LGTTGGGFRVWESSASDGDLDKVRSTVKQFYRDWSDEGKAEREICYGGVM
KELEERFGMVEDKSAIRVLVPGAGLGRLAFDIAVAGYTSQGNEFSYHQLM
ASNYILNHTTTAYQHTLHPFISIFSNHSTRPDHLRGIQIPDVHPETLLEL
TGTDRFSMTAGDFRQSYKDLPPSQKFDVCATVFFIDTAPNLISYLETIKH
LLVDDGIWVNFGPLLWHFEEHAQEQQQRKRRDSGEDEDVGAAGKFELCLD
EVLALVQMCGFKLEKVITGAKTGYVDDEKSMLRHEYEGVFWVAIKA

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAD41YI16FM1 conserved hypothetical protein [Ajellomyces capsulatus NAm1]1e-29
SY0AAD5YH23FM1 hypothetical protein FG01856.1 [Gibberella zeae PH-1]3e-41


Manual Annotation:

Please find below the necessary files for GSTUMT00004303001 annotation :

link to GSTUMT00004303001 Artemis file
link to scaffold_11 sequence file
link to scaffold_11ESTs