Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004128001
Length(AA) : 457
Localization : scaffold_10
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE64562.1| Score: 502 E_value: 8e-50
KEGG Definition: ankyrin
Accession: aor:AO090138000202 Score: 502 E_value: 4e-50
KOG Definition: Ankyrin repeat and DHHC-type Zn-finger domain containing proteins
Classification: [General function prediction only].
Kog Number: KOG0509 Score: 149 E_value: 2e-10
PFAM Definition: No Hit Found
Swissprot: Q502K3|ANR52_DANRE

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.299NO0.608NO0.240NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.080.2910.703_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=6.05348First60=0.00022PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004128001
MFQTIAVGKRTFICVDALDECVPEHRMVILEALGQILRGSPGTRIFMTGR
PHVRSDVERKFDGEVTFLVIQPSEDGFIRFLHEKLRNDTSPDTMSAGLEA
AIMKSIPELSSETFLLASLHMNAILQETTIARRRNRLMSLKNGAGLGDAY
GVTLERIRAQDKGKVELAIATLTWICHAERPLLVDELCHALAVEIGETHF
DPENVPSLGTLLGCCQGLITVDKEASIVRLIHFTVQEYLCAQPDLFRRPH
STIAETCLTYLNSCQVENPSSDPLLDCESMPFLKYSSRYWGIHANREFSK
HVRTLALKLLCQYKDHISAIYLLKQVLRPKYIELIGTPILFPGLHCASFF
GIVELMTALINDKGCDINQRDSIDRTPLAWAAGMGHEEMVMILLEREDVD
PSLPDNYDRTPLGWVALDGHEEVVKLLLGRGMSTPIMQIILVGHHSGLLL
SRDMKDW

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAD61YK03FM1 Ankyrin repeat protein [Aspergillus fumigatus A1163]4e-38
SY0AAD63YN23FM1 conserved hypothetical protein [Aspergillus terreus NIH2624]2e-31


Manual Annotation:

Please find below the necessary files for GSTUMT00004128001 annotation :

link to GSTUMT00004128001 Artemis file
link to scaffold_10 sequence file
link to scaffold_10ESTs