Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004084001
Length(AA) : 490
Localization : scaffold_1
Number of EST contigs matching the gene: 2
Number of ESTs : 8
  User annotation : TmelHARS  [+]

Blast Results:

Nr Definition: hypothetical protein SS1G_09999
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001589364.1| Score: 1600 E_value: 1e-176
KEGG Definition: hypothetical protein
Accession: ang:An01g08490 Score: 1563 E_value: 1e-172
KOG Definition: Histidyl-tRNA synthetase
Classification: [Translation
Kog Number: KOG1936 Score: 1584 E_value: 1e-177
PFAM Definition: tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T). Other tRNA synthetase sub-families are too dissimilar to be included. This domain is the core catalytic domain of tRNA synthetases and includes glycyl, histidyl, prolyl, seryl and threonyl tRNA synthetases..
Pfam Number: pfam00587 Score: 289 E_value: 1e-26
Swissprot: O43011|SYH_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.059NO0.281NO0.050NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1460.050.833_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01681First60=0.0002PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004084001
MVIRDKIFSTITDVFKRHGAVTIDTPVFELREVLTGKYGEDSKLIYDLAD
QGGEICSLRYDLTVPFARWLAMNPTIQSIKRYHIAKVYRRDQPAMTKGRM
REFYQCDFDIAGTYDPMLPDAEILRITTEILDNLDLGNYTIKINHRKILD
GLFQVCGVPIDKIRSISSAVDKLDKATWEDVRREMTEEKELDPEVADRIG
GYVQKKGGRELLDELLEDENLTSNEAFASGLKDMGLLFDYLEVLHVMPKL
SFDLSLARGLDYYTGIIYEVVTEASAPPAGKSAKLRRAPKSDDPDADRSS
DDSIGIGSIAAGGRYDELVGMFANSAKGRVPCVGISFGVDRIFSITKARM
TGEVRGNEVEVYVMAFGGKGFTGLLKERMEVCRILWDAGVKAEFMYKNKP
KLPHQFAGAEKNGVPFAVVLGEDELKEGKVKIKEMGLPEGHPEKNGVDIN
MDGLVAQIRKRLAKKEGGAGAVGIEGNLRSVALEEKTPEV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig2753 hypothetical protein An01g08490 [Aspergillus niger]4e-55
Contig4383 hypothetical protein BC1G_07247 [Botryotinia fuckeliana B05.10]1e-81


Manual Annotation:

Please find below the necessary files for GSTUMT00004084001 annotation :

link to GSTUMT00004084001 Artemis file
link to scaffold_1 sequence file
link to scaffold_1ESTs