Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004046001
Length(AA) : 898
Localization : scaffold_1
Number of EST contigs matching the gene: 3
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CHGG_05413
Specie: [Chaetomium globosum CBS 148.51]
Accession: ref|XP_001221508.1| Score: 1452 E_value: 1e-158
KEGG Definition: hypothetical protein
Accession: fgr:FG03419.1 Score: 1401 E_value: 1e-153
KOG Definition: ATP-dependent DNA helicase
Classification: [Replication
Kog Number: KOG0351 Score: 775 E_value: 1e-82
PFAM Definition: DEAD, DEAD/DEAH box helicase. Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression..
Pfam Number: pfam00270 Score: 247 E_value: 2e-21
Swissprot: P15043|RECQ_ECOLI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.386NO0.692NO0.258NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.9360.0330.087M123

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.29681First60=1.1925PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004046001
MAYRALAYRSRVVRFPSLSIRVVGPMSSFGHVTLHPPPPPLRFNGQNTPL
VTVSPFSTTASRGRGGLNMEEAEERYAFDSENEAQLSRMQEVEESHAFDS
ENEAQLSRMQEVEESHAFDSENEAQLSRMQEVEESHAFDSENEAQWHMQV
EECHTFELEIEERSSYTQVKESHAFDSENEAQFFQYGSDQRAEPAKPASG
RKWTRFKRGRKGSGSDHSRGIDPNDTTEYPATSELAHKIMRETWGFNEFR
SQQEKVISRLIHGGSAVIVFPTGGGKSLAFQIPALALDEHDESMGQEKGG
ISIVVSPLIALIKDQVEALQKRGVKAAAIDSTQTRESILNTYDLLRKGEL
KLLYCAPERLNNEAFVEMVRRTRVRLIAVDEAHCISEWGQAFRPDYLKVA
RFVKEMNAERVLCLTATATPKVCKDILKAFGVPESGLFKNPTYRENLSLL
AEHFETIEGKLAKLSDFLYSNPGSSIVYVTTQKQAEVVAQALTVAGVEAM
HYHAGMTKDERSYAQDEFMNRNDLTIVATIAFGMGIDKPDIRNIVHYDFP
RSLEGYSQEIGRAGRDGNESKCMLYLCGEDWVQREFFCRLDLPSKKSVNN
LLRELFASNEGVEVGDVIETDINLQSRNHDIKINALNLLYSQLELRFELL
RAITPKYSTYRFVQSDGFASFTATDDPITKVLLESMQKKIKRKSMMRSVD
IDQLSQEHGFKREELVYRMQSFSAQGLIELNPGRVHQRYRILKPFPKDEA
DIQELIDKAYEQMEQREMDDLRRSKNVIELITSPGCIAQGLAKYFGDENS
VKSEGCGKCQFCNTREPLTFSKPIIKKSPVDPYRLEEVLKGCRVRDDPRL
LAKVAFGISSPRIRMERIGERNPIFGSMVDCDFDELMNEFAKHCTLEE

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3664 hypothetical protein SS1G_01987 [Sclerotinia sclerotiorum 1980]5e-15
SY0AAA47YD04FM1 No hit found
SY0AAA9YO17FM1 hypothetical protein FG03419.1 [Gibberella zeae PH-1]2e-47


Manual Annotation:

Please find below the necessary files for GSTUMT00004046001 annotation :

link to GSTUMT00004046001 Artemis file
link to scaffold_1 sequence file
link to scaffold_1ESTs