Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003993001
Length(AA) : 363
Localization : scaffold_1
Number of EST contigs matching the gene: 6
Number of ESTs : 131
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_03409
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001595320.1| Score: 617 E_value: 4e-62
KEGG Definition: RTA1 domain protein, putative
Accession: afm:AFUA_5G01230 Score: 578 E_value: 6e-58
KOG Definition: No Hit Found
PFAM Definition: RTA1, RTA1 like protein. This family is comprised of fungal proteins with multiple transmembrane regions. RTA1 is involved in resistance to 7-aminocholesterol, while RTM1 confers resistance to an an unknown toxic chemical in molasses. These proteins may bind to the toxic substance, and thus prevent toxicity. They are not thought to be involved in the efflux of xenobiotics..
Pfam Number: pfam04479 Score: 465 E_value: 3e-47
Swissprot: Q08417|RSB1_YEAST
Gene Ontology:
GO:0005783 = Cellular component: endoplasmic reticulum
GO:0016021 = Cellular component: integral to membrane
GO:0005886 = Cellular component: plasma membrane
GO:0004012 = Molecular function: phospholipid-translocating ATPase activity
GO:0015908 = Biological process: fatty acid transport
GO:0045332 = Biological process: phospholipid translocation
GO:0009636 = Biological process: response to toxin

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.179NO0.841NO0.228NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0860.4440.747_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=171.368First60=20.8428PredHel=7
Topology=(37-56,63-85,100-122,135-157,177-199,219-241,256-278)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003993001
MSEKLIEGHNMTYWNSIDCDLDICPLKASFWDYRPSLALNYLLIALFGLS
MLAHIGQGIKYKTWGFLASMFLGCFTEIIGYAGRIWAYHEPFSMDPFLMQ
ICSLTLAPAFLCAGIYLCLSRIVMVFGAETSRIPPKAYTYIFVTCDFVSL
CLQGAGGGIASTLSQDDKDPAPGNNVMLAGLGFQVFTLVLFMLLCAEYAY
RVKNTTQSFDVTHAKLRSSKKFRGFLAALSLATILIFIRSIYRVIERAQG
WDGELTKNETLFFVLEGVMVVIAVLVLNVFHPGWCFREAILDQLGFGKKS
VFRNLGGEAMRWKCHFCCAPSWLITPPPPAGFLVYVFASRLFCLFRFVLV
SRVGTDIYMDYHL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig453 No hit found
Contig965 hypothetical protein BC1G_10778 [Botryotinia fuckeliana B05.10]2e-50
Contig2189 hypothetical protein BC1G_10778 [Botryotinia fuckeliana B05.10]7e-16
Contig2937 hypothetical protein FG06656.1 [Gibberella zeae PH-1]5e-20
SY0AAA23YH15FM1 hypothetical protein FG06656.1 [Gibberella zeae PH-1]9e-23
SY0AAB20YH01FM1 hypothetical protein BC1G_10778 [Botryotinia fuckeliana B05.10]1e-30


Manual Annotation:

Please find below the necessary files for GSTUMT00003993001 annotation :

link to GSTUMT00003993001 Artemis file
link to scaffold_1 sequence file
link to scaffold_1ESTs