Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003887001
Length(AA) : 450
Localization : scaffold_1
Number of EST contigs matching the gene: 2
Number of ESTs : 5
  User annotation : No user annotation

Blast Results:

Nr Definition: unnamed protein product
Specie: [Aspergillus oryzae]
Accession: dbj|BAE61028.1| Score: 812 E_value: 1e-84
KEGG Definition: TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation)
Accession: aor:AO090012000927 Score: 812 E_value: 6e-85
KOG Definition: TFIIF-interacting CTD phosphatase
Classification: [
Kog Number: KOG1605 Score: 575 E_value: 8e-60
PFAM Definition: NIF, NLI interacting factor-like phosphatase. This family contains a number of NLI interacting factor isoforms and also an N-terminal regions of RNA polymerase II CTC phosphatase and FCP1 serine phosphatase. This region has been identified as the minimal phosphatase domain..
Pfam Number: pfam03031 Score: 565 E_value: 1e-58
Swissprot: O59718|NEM1_SCHPO
Gene Ontology:
GO:0005783 = Cellular component: endoplasmic reticulum

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.086NO0.318NO0.130NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3790.0360.627_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.08169First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003887001
MNSLSILSSRVDKVIGATTPPATQRTDPFKPLRRGQRSGSLRSFEDRGYQ
PKRDLKQSVCYDDDGDGDEEEVEEEDGPEDYEEDEHGDLLLDKGQRSVGY
GMWLLGPWLGAFRWFFSTLSSSGGWLISFLYNDDGVFSPLLPIKRFAAIL
LGPFGGFQGRVTEYSDYEKSGFDDTSAIMSDSEVLHHYGSDSGMDPTPPA
HHLRSRPFNRDSPFLIDEIVPRRSIRIRLYSEESATITKPTSVKSPTSPS
PSLRLTKYPRSSGPTKPLLPSHPSPKTLILDLDETLIHSLAKGGRMTSGH
MVEVKLDRQHAILYYVHKRPYCDEFLRMVCKWYNLVIFTASVQEYADPVI
DWLEQNRKYFKGRYYRQHCTQRGGAYIKDISAVEPDLSKVMIIDNSPMSY
IFHEDNAIPIEGWINDPTDIDLLHLIPLLQALQYVTDVRALLALRMGEID

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1370 conserved hypothetical protein [Aspergillus terreus NIH2624]2e-75
Contig4226 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00003887001 annotation :

link to GSTUMT00003887001 Artemis file
link to scaffold_1 sequence file
link to scaffold_1ESTs