Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003883001
Length(AA) : 332
Localization : scaffold_1
Number of EST contigs matching the gene: 2
Number of ESTs : 9
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SNOG_05041
Specie: [Phaeosphaeria nodorum SN15]
Accession: ref|XP_001795453.1| Score: 359 E_value: 3e-32
KEGG Definition: hypothetical protein
Accession: ncr:NCU08931.1 Score: 351 E_value: 1e-31
KOG Definition: Alkyl hydroperoxide reductase
Classification: [
Kog Number: KOG0855 Score: 282 E_value: 6e-26
PFAM Definition: AhpC-TSA, AhpC/TSA family. This family contains proteins related to alkyl hydroperoxide reductase (AhpC) and thiol specific antioxidant (TSA)..
Pfam Number: pfam00578 Score: 249 E_value: 4e-22
Swissprot: O94561|PRX_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.093NO0.113NO0.060NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4610.0250.648_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00074First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003883001
MSEPVLRRSGRNIAKKEAAPPPPAPGPAPKKRASTEPKKPSAKKARTVVD
KAPTVVKNAVSKDKDSKKEDASKKKPEGEASASAAAAEVKAAPIPAAESS
SAAPTVTTTIVTTTAGTKSAAKAKSGKAKAKRADAAEEAAAALGDGDLLP
NTLPEVQTHDGGKTTLTAILAQASKGIVIFAYPKASTPECTTQACLFRDN
YTAFTDAGYSVYGLSGDQPVANEKFRNKQNLTYTLLCDPTYELHEKLGIK
KSPKGTVRSVIIIEKTSGDAAAATHPGKILRKTKASAHVSLQVAKEVVGL
DGTKKDAEGGGKKDAAGDVTLPDAGAAGEGVA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1202 No hit found
SY0AAB3YO09FM1 hypothetical protein NCU11374 [Neurospora crassa OR74A]4e-08


Manual Annotation:

Please find below the necessary files for GSTUMT00003883001 annotation :

link to GSTUMT00003883001 Artemis file
link to scaffold_1 sequence file
link to scaffold_1ESTs