Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003858001
Length(AA) : 705
Localization : scaffold_1
Number of EST contigs matching the gene: 2
Number of ESTs : 10
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein
Specie: [Yarrowia lipolytica]
Accession: ref|XP_500272.1| Score: 2618 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: yli:YALI0A20108g Score: 2618 E_value: 0.0
KOG Definition: Predicted NAD synthase
Classification: [
Kog Number: KOG2303 Score: 2852 E_value: 0.0
PFAM Definition: CN_hydrolase, Carbon-nitrogen hydrolase. This family contains hydrolases that break carbon-nitrogen bonds. The family includes: Nitrilase EC:3.5.5.1, Aliphatic amidase EC:3.5.1.4, Biotidinase EC:3.5.1.12, Beta-ureidopropionase EC:3.5.1.6. Nitrilase-related proteins generally have a conserved E-K-C catalytic triad, and are multimeric alpha-beta-beta-alpha sandwich proteins..
Pfam Number: pfam00795 Score: 261 E_value: 3e-23
Swissprot: P38795|NADE_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0016811 = Molecular function: hydrolase activity
acting on carbon-nitrogen (but not peptide) bonds
in linear amides
GO:0042802 = Molecular function: identical protein binding
GO:0003952 = Molecular function: NAD+ synthase (glutamine-hydrolyzing) activity
GO:0009435 = Biological process: NAD biosynthetic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.474NO0.744NO0.335NOY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0450.5310.546_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01224First60=0.00034PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003858001
MGHLAVLATCSLNQWALDFEGNAERIIESIRIAKEAGASLRVGPELEITG
YGCLDHFLEGDTYLHSWEILAKIIAHEDCQDILLDIGMPIGHKNIRYNCR
VIAHNKRILLIRPKIYLANDGNYREMRYFTGWGRTKYVEEYYLPRIIMTI
TGQRKVPFGDAAISTLDTCIAPETCEEMFTPNSPHIGMSLDGIEIMTNSS
GSHHELRKLQTRIELMTEATKKCGGIYLYANQQGCDGDRLYYDGSAMIGI
NGKIVAQGTQFSLQDVEVITATVDLEEVRSFRFAPSRGVQAVQNTPYQRI
EVDISISAPSDRAEISLKPTPTIDIRYHSPEEEIALGPACWLWDYLRRCG
GVSGYFLPLSGGIDSCATATIVHSMCRLVHEACENGEEQVIKDARRVCGE
PEESTWVPRTPQELAGRIFHTCFMGTKNSSADTRARAKELADAIGAYHID
LDMDFLVKAVTDLFSLVTGKRPQFRVHGGTKTENLALQNIQARLRMVLAY
LFAQLLPWCRGKQGGLLVLGSANVDECLRGYMTKYDCSSADINPIGGISK
TDLKRFISYATAKFNLPILHSFLTAIPTAELEPITSTYVQSDEADMGFTY
DELSTFGQLRKNHKLGPWSAFNRLLHEWGDRMSPRAIATKTRNFFYYYAI
NRHKMTVLTPAYHAEQYSPDDNRFDLRPFLYPPFSWPFRKIEETVAAINA
REKMD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4447 glutamine-dependent NAD(+) synthetase [Neosartorya fischeri NRRL 181]2e-49
Contig6033 hypothetical protein [Yarrowia lipolytica]0.0


Manual Annotation:

Please find below the necessary files for GSTUMT00003858001 annotation :

link to GSTUMT00003858001 Artemis file
link to scaffold_1 sequence file
link to scaffold_1ESTs