Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003752001
Length(AA) : 950
Localization : scaffold_189
Number of EST contigs matching the gene: 3
Number of ESTs : 6
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_14726
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001546912.1| Score: 1834 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ani:AN4322.2 Score: 1677 E_value: 0.0
KOG Definition: Protein kinase
Classification: [Signal transduction mechanisms].
Kog Number: KOG2137 Score: 782 E_value: 2e-83
PFAM Definition: Pkinase, Protein kinase domain..
Pfam Number: pfam00069 Score: 207 E_value: 9e-17
Swissprot: Q9P7X5|PPK32_SCHPO
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0004674 = Molecular function: protein serine/threonine kinase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.093NO0.199NO0.071NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2940.0670.701_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01123First60=0.00018PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003752001
MFANALKSFTSNITSNYTLSPSPSGHSGPWKIYDAKKKKNPNQAVSVFVF
ERKSLDSGGSSGGLSLRGSSSKDGLRAAQDEVVDRLKKEASLLARLRHPS
ILELVEPVEEMRGGGLMFATEPVMTSLAILLAEKDEEERSSGGRYVADDG
KGGRRRREVEIDELEIQKGLLQVAKGLEFLHESASLIHGNLTPESIILNV
KSDWKLTSFSFTVTSVNPPLPAPYDPRLPSSVQLSLDYASPDLVLDQNLT
PSADLFSLGLLIVALYNHPHRSPLETHHATSTYRRLLASASTTPNSGNNY
LSSRPLPRPLVETLLSRLLTRRPAGRVTACGFQQSPYFDNILVSTLRFLE
SLPAKTPSEKSSFMRGLLKVLPQFPRGVLEKKILPGLVEELRDGSMLALV
LPNIFLIAENASARLFSEKVLPKLKEVFINHVPSTTEHKTAAAKIAERER
ESGREGGLTVLLSNLNIIKDKTTAKEFKEDILSVHRAALESPTHALQDLA
LRSIPTILPKLDFPTLKNDLFPAVASVFTKTSSLGIKIRGLEAFKVLCSP
AAAATSDAPELDKYTIQEKLIPLLRGIKTKEPAVSMAALDVFKVIGKTCD
REVVAMEILPCLWSMSFGPLLGVEQFTAFMEVVRQVSSRIEAEQVRKLQE
LRTEGESGAGAGGILSFGGMPGISSGITGGGGDDNFENLIFGRGGGDKSL
LVNNGGFDTPWNSTNAGGGGTVTAQRSEPRFSWSTPSSTTNLHSSSSFSG
EVLQPQQQTRTMTPEAKMSFQPLTPTSPSHSTALNSMSKNAFSNLNLGSG
FGSTTSLRPQPSHPQSVSSTSSSGGGIDWSAAATRRSFSSTTSNTQTSSL
WDTPPLKPTQSPLGGGFKPPAQQNQQQNHPTILYGQTRQQPAPTTSTGAF
SGFTIPPPPGADTSSAGGGTPGGGFTLTLPTSMNKKSTEKKGLDAYESLL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3801 hypothetical protein BC1G_14726 [Botryotinia fuckeliana B05.10]1e-104
SY0AAA43YD11FM1 No hit found
SY0AAD39YF06FM1 hypothetical protein SNOG_06786 [Phaeosphaeria nodorum SN15]2e-37


Manual Annotation:

Please find below the necessary files for GSTUMT00003752001 annotation :

link to GSTUMT00003752001 Artemis file
link to scaffold_189 sequence file
link to scaffold_189ESTs