Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003624001
Length(AA) : 3119
Localization : scaffold_182
Number of EST contigs matching the gene: 3
Number of ESTs : 16
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_05729
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001592808.1| Score: 9422 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An04g04950 Score: 9040 E_value: 0.0
KOG Definition: Vacuolar protein sorting-associated protein
Classification: [Intracellular trafficking
Kog Number: KOG1809 Score: 1366 E_value: 1e-150
PFAM Definition: DUF1162, Protein of unknown function (DUF1162). This family represents a conserved region within several hypothetical eukaryotic proteins. Family members might be vacuolar protein sorting related-proteins..
Pfam Number: pfam06650 Score: 571 E_value: 2e-58
Swissprot: Q07878|VPS13_YEAST
Gene Ontology:
GO:0019898 = Cellular component: extrinsic to membrane
GO:0005739 = Cellular component: mitochondrion
GO:0005515 = Molecular function: protein binding
GO:0045324 = Biological process: late endosome to vacuole transport
GO:0045053 = Biological process: protein retention in Golgi
GO:0030437 = Biological process: ascospore formation
GO:0007039 = Biological process: vacuolar protein catabolic process

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.675YES0.913YES0.579YESN

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.030.7840.356S317

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.13771First60=0.08321PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003624001
MLAFGGWFSEWLIPSLADISVFLSGDVRLRNLELKKEALDQMKLPLNVME
GHLGQLTLQIPWSNLKGKPVKVIIEDVYLLANPKADQEYNEEEEQRRKQA
VKQEKLQNAELLQDRNTEGMSVEELQKNQSFTNSLVTKILDNLQITVKNI
HIRYEDSLSTPGHPFSLGFTLEEFSAVSTNENWEPNFIQDNVSVTHKLAK
LGSLAIYWNTDSKHFGGRPDAHATMVKGFKGLIASESNIPSGHQFVLKPV
SGTGHLEVNKTGRADVPKMVARMIFDEIGFILDEDQYRDVLMMVDNFHFY
LRHQQYKRYQPKGKSPKEDPMAWFLFAGNAVLSKIHEKNKKWSWDYFRER
RDDRKQYIKLFKQLKQYEQLAASEAEELKKLEWKLSYEDLRFYRSLARNQ
LRKDRALVKKPEHQGAQGWVSWMWGSVQKKEEEPSTIMTDQQRKELYEAI
DWDEKKAIAESIDLPRDSVKMQVEASLRTGSFTLKRDPHGDGAEILALLF
DTFKSRVLQRPDSFYGELSLGGLRVYDGTTKGSLYPQIVRVKDAVSALGL
DELDDDDEDVPKESNPDAPFFQASFERNPLDESADSAVTMKMRSMEIIYN
PIFVEEIYNFFKPPERHMESIGALMESAGATVEGIRQQTRAGLEFALEEH
KTLNAKLDLQAPLIIIPESICDEKSNCLILDAGHVSLTSDLVKKGDIREI
HSKQRQQYSQEDYARLESLMYDKFSLNLESTQVLIGPSVEETKLQLRAKS
DRKHLHIVDRININFTVDISILPKASNLTKFRMSGHLPVLHASLSDKKYK
ALMKIIDVAIPKLGREDSPNPRKSVRQPAQDWKSKPMPNQTHEHFEEASD
GIQNDSPSTHQRTFELKFTVGELRGSLFRADPEGKNPDKQLVLLVAEHFA
LDFHIRPFDMAAEVILKSLNIEDLIDDDPSTTFKRIVTSDTLQEQSNDNP
LFFVKYVKVKRESPEFMTVYEAIETNVDVSISTINVVITRKTVLTLLDFA
ITTFTNPGNNQTKAAIQSTKGATYSSGEEASDLAIPNDPLEAEKIRVKIN
LDSISLILNNDGIRLATLSLASADVGMFLMGKTMRIGARLGNFSLFDDIN
EGAEENSPLRQLVTIQGDELADFRYETFDPEAIQSYPGYNSSIYLRSGSI
KVNFVEEPFRKIIDFAVKFGKMQALFNAARQAAMNQASQMQENANQIHFD
ILVRTPIIVFPRTNFAHHAERDLLTAYLGELYAQNKFVPLNNSEDSAVVN
KISAGIRKTRLTSVFYFNQGQKEELELLDKLDISFGVTYLEHTCNAERPD
LEIEGSMSDLNLKLTQTQFKFLLELSRSIPAVFTSDPKEEGLVEQLPVEN
IEPAKKAIQQTSEESAQVVNLNPELGVSSDTWTKVDMVFSVGSVALELFT
ADPDNPIGDLEGASLSRASLSNTNVKLRMISDGSIESELLIDSFNIRDSR
FQETNKFRKIMSSTNDQGSQFMASVTISGGVERNLVALLTIDSPRIIFAL
DYIFALRNFVMSALETDEGPLAEASEESSESEDDLSERNDKVKETNEAIP
VSFQVNIVDSQVILIANPGISNSEAIVLSTKQILVSQQHALTLQIEEVGM
FLCRMDKFETSRLRILDDFAIAGSMDNRSLGVNQSIQSIQIDVDPLVLRV
SLRDILLATQIFNKASEMSSPNKGKPEIQGEAKRLGTSKASGKSLRRRTA
SGKEPSTAARQGAKSSATARSQTSQFQQGPGRQPASTIVKREGLSANFAG
MRVILIGDQHELPLLDLSVKHFNARVKDWSGELDADTSIELFMNIYNFSK
SAWEPLIEPWQLDFHMSRSVQQEKLSIDLISRKMLELTITSQTIALASKA
AQFMQQDEDILTKPRGADSPYRIRNQTGFPLHVWAASDPLLGEPMAVKLE
DGEQVPWRFEEWEKMRENLSPDGSSGIVGIKIENSGFESITEIPVNKEGE
TLYTLRPPKDNTLHRLLCEVHLGTDNVKYITFRSPLIIENNTQIPVEIGV
LDVEAQHIVRVYKILPGESQPAPIETAYHQSVVVRPDAGFGYNWSQDHLF
WRTLLKKPTKCLNCNSEEGNNAPPFYFQMHATFSRNNPVAKLYPYMRIQL
SAPLEVQNLLPYDFKFRIYDKHTKKEWTNFLRKGGLSPVHVIELSHLLLM
SIDMQDTVYSASDFAIINSDSTEFDKETTLVAKDNQGLELRLRLHYFPIA
NSGGAFRVAVYSPYVILNKTGLTMMVKSKSLLQSAKVAAGQMQTSAGSSQ
RAVPYMFSYPNDDRQNRAVLKVGDSIWSRPHSFEAIGNVADVVLPSSTKE
TELHIGISVDEGEGKYKMTKIVTLTPRFILKSKLSEVIQIREPGTGSKNI
MTLNPGELLPLHFLKASERKQLTLLFPGINNRWSSSFNISDLGSVHVKMH
KANQRQSLIRIDILQEKATIFLHLSIEKKNWPFSMRNESSQEFTFYQADP
NQDDDEEKESDFRPVYYKLPPRSIMPYAWDFPAAKSKELVLMVHNQKRHV
RLAEIGNLVPFKVETGVIGEDGNPIKKTIEINVRADGPTQTLVLSNYRPS
KSLYKPKTNASSSSIATSAGFEVKDGDSDITFQVQIRFAGIGISLINRQI
KELAYITFRDLEVKYNESSLLQTLNVLLKWIQIDNQLYGGLFPIILYPSV
VPKTGKEMDVHPSLHTSITRVKDDSYGVLYIKYATFLLQQMTLEIDEDFI
YALLDFSKIPGASWMEYDDGKFAGQDMYFELLNIQPAQLDISLLRTEVVN
VEDKTSSRNPLLFILNVFTMAIGNINDAPVRLNSLMLENARVSMPVLARH
LQTHYSNEFLYQIHKILGSADFLGNPVGLFNNISSGVWDIFYEPYNGFIM
TDRPTELGLGLAKGATSFFVQVYGHRLHEGLAAATLDKQFQDRRRISRAR
NRPKHALYGVTSGADSLITSFASGFGGLARKPLEGAEREGALGFLKGLGK
GVVGLATKPAIGVFDLASNVTEGIRNTTTVFDAEGLDRVRLTRYIGQDGV
VRPYSQREALGQFWLKQLDNGKFFDDEYIAHLELPEQDLVVMLTYSRIML
VKAKRLYCEWDLPLNELQTISMEKTGIALMLRGGRQGPFIPTRDESSRKF
LFKKIGLAVNSFNSTAAVS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig187 hypothetical protein SS1G_05729 [Sclerotinia sclerotiorum 1980]1e-161
Contig7140 hypothetical protein BC1G_09404 [Botryotinia fuckeliana B05.10]0.0
SY0AAC57YJ20FM1 hypothetical protein SNOG_14324 [Phaeosphaeria nodorum SN15]8e-39


Manual Annotation:

Please find below the necessary files for GSTUMT00003624001 annotation :

link to GSTUMT00003624001 Artemis file
link to scaffold_182 sequence file
link to scaffold_182ESTs