Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003562001
Length(AA) : 576
Localization : scaffold_178
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001215253.1| Score: 170 E_value: 5e-10
KEGG Definition: predicted protein
Accession: aor:AO090003000221 Score: 168 E_value: 4e-10
KOG Definition: Splicing coactivator SRm160/300
Classification: [
Kog Number: KOG1869 Score: 149 E_value: 3e-10
PFAM Definition: TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha). Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) or RNA polymerase II-associating protein 74 (RAP74) is the large subunit of transcription factor IIF (TFIIF), which is essential for accurate initiation and stimulates elongation by RNA polymerase II..
Pfam Number: pfam05793 Score: 114 E_value: 4e-06
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.142NO0.445NO0.143NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0810.3780.63_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=22.4893First60=0.05008PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003562001
MTTEGLNMALQAASHVPALASTITVMDTSGKVVNTSKNIFSAFKEARTAY
RTRKAEIAEERARQSARRDEARLRAARKHSASAARRLERSNTGVLMIEDD
EERRRRKKEKKEKKQRSSSSSSSGTGSDISFEDNSGSTVLTTTNNNHSVT
RSNSSETMRTEATLFTPGGLRGNMSVISLIPEMVLSQPDPMTENLQLLLL
QLQATIDELSCWSAGIAALISELQKVPDTLAVVGFTLAEISALVAKVSPA
AIMGLKTLFPMIFALLGSPQFVVLAGVGAAATVIVLGGYKIIKNVVGGGA
AKASLSGGDEDEYPEGDWDEPVEEIVREPPREQRMIEAAPTPPAQPELRR
AQSEAPTQRRQLMPARVHTSPVPTGKSEVLAFDISSASSGGSSGSSSNNS
SNSNSTNNSGDEEGVKRHHRKRRGSNDKSEKDKSEKSRSKSGSSSHHSKS
KSDKEKGKSEKDKSSSKSDKHESSEPSSRRGSSSKSHDKHEKSDKKERKT
SVDGGAATPTKEKKPFFSLTTSPFSSPAGSTTSLPTEKQKKKERKSSLSS
ASSAKEHKEAKKPKEFLSGIFEGRSA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1506 conserved hypothetical protein [Aspergillus terreus NIH2624]5e-07


Manual Annotation:

Please find below the necessary files for GSTUMT00003562001 annotation :

link to GSTUMT00003562001 Artemis file
link to scaffold_178 sequence file
link to scaffold_178ESTs