Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003504001
Length(AA) : 611
Localization : scaffold_175
Number of EST contigs matching the gene: 5
Number of ESTs : 217
  User annotation : TmelPLAG1  [+]

Blast Results:

Nr Definition: zinc finger protein
Specie: [Ascobolus immersus]
Accession: emb|CAA67549.1| Score: 818 E_value: 4e-85
KEGG Definition: hypothetical protein
Accession: ang:An16g07795 Score: 780 E_value: 5e-81
KOG Definition: C2H2-type Zn-finger protein
Classification: [Transcription].
Kog Number: KOG2462 Score: 135 E_value: 1e-08
PFAM Definition: No Hit Found
Swissprot: Q5U2T6|PLAG1_RAT

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.082NO0.219NO0.063NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.170.0690.802_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00105First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003504001
MAASSSSQAPTSASIPTKDTTGMADFVLFDDDPLYQEYRPRYDNGGFPQS
GVDSYVAMLEQPSEDHQPKLYMAGLQPGSTSFETYPPYAYDEVPLTMGYE
PGPAPGVLIHPPTLPYSPHGNITASLEYRTPISPATSAGGPEGSSAGSEA
GSTGSPYPQQIDDPFSSVYVDIDPSLIMPSPSQQFEDPCSAASSRGSPSW
HSAHSPPPTSNPSSPELGKRSGGRLSPLRQYRTAPYPSRRLSVTSQSSSR
SYGSPSGPSELEDMYPAAPGDIPRRAPSSNGSGTGKDTLCPECKKSFRDL
KAHQLTHQLERPVKCPIATCEYSKKGFARKYDCQRHTLTHYKGTMVCGFC
PGSGSAAEKSFNRADVFKRHLMSVHNVEQTPPNSRKRPPTKTSPAEDRYA
GAYVTGKCSTCSITFATAQQFYEHLDECVLSKVVQEEPAAAFNEMNLDSV
KLSDMDPPSSNPADPTSSDSEDEDEDEKDTTFNPATNKSAAKIRIKKGTI
KHSGSGAGSTQSAKTKTIRRKRKNFPAGWGCQPEQMVTKRRCLMVFDGPK
LLCRDEMMMSNEWEVRAQLGGSGGSDAYISDLDFWTLRRAEAFLDAAPSR
NPQGAAVGEVR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1321 No hit found
Contig1784 zinc finger protein [Ascobolus immersus]3e-85
SY0AAA36YA12FM1 No hit found
SY0AAA38YH05FM1 hypothetical protein An16g07795 [Aspergillus niger]5e-07
SY0AAB57YA19FM1 conserved hypothetical protein [Aspergillus terreus NIH2624]5e-36


Manual Annotation:

Please find below the necessary files for GSTUMT00003504001 annotation :

link to GSTUMT00003504001 Artemis file
link to scaffold_175 sequence file
link to scaffold_175ESTs