Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003465001
Length(AA) : 135
Localization : scaffold_173
Number of EST contigs matching the gene: 1
Number of ESTs : 1
  User annotation : No user annotation

Blast Results:

Nr Definition: beta-tubulin prf||1312295A tubulin beta
Specie: [
Accession: gb|AAA33328.1| Score: 378 E_value: 7e-61
KEGG Definition: tubulin subunit beta; K07375 tubulin beta
Accession: tpv:TP02_0464 Score: 306 E_value: 4e-52
KOG Definition: Gamma tubulin
Classification: [Cytoskeleton].
Kog Number: KOG1374 Score: 232 E_value: 9e-21
PFAM Definition: Tubulin, Tubulin/FtsZ family, GTPase domain. This family includes the tubulin alpha, beta and gamma chains, as well as the bacterial FtsZ family of proteins. Members of this family are involved in polymer formation. FtsZ is the polymer-forming protein of bacterial cell division. It is part of a ring in the middle of the dividing cell that is required for constriction of cell membrane and cell envelope to yield two daughter cells. FtsZ and tubulin are GTPases. FtsZ can polymerise into tubes, sheets, and rings in vitro and is ubiquitous in eubacteria and archaea. Tubulin is the major component of microtubules..
Pfam Number: pfam00091 Score: 297 E_value: 3e-28
Swissprot: O42786|TBB_MYCPJ

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.077NO0.210NO0.071NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1050.0380.923_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.0183First60=0.00096PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003465001
MREIVHLQTGQCGNQIGAAFWQTISGEHGLDGSGVYNGTSDLQLERMNVY
FNEASGNKYVPRAVLVDLEPGRITSSLDNPVLVTTGPRAIIPRVLNLSTR
CWMSFVVRPKAATVCKVSRLLTRLVVVLALVWERS

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB8YM21FM1 beta tubulin [Sclerotinia sclerotiorum 1980]7e-97


Manual Annotation:

Please find below the necessary files for GSTUMT00003465001 annotation :

link to GSTUMT00003465001 Artemis file
link to scaffold_173 sequence file
link to scaffold_173ESTs