Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003442001
Length(AA) : 176
Localization : scaffold_172
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_09739
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001589106.1| Score: 234 E_value: 2e-18
KEGG Definition: hypothetical protein
Accession: yli:YALI0F19690g Score: 178 E_value: 4e-12
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.042NO0.077NO0.031NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3090.020.781_30

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.03783First60=0.00015PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003442001
MPPARPRPNLHDDSRSETSVGKPDREKSIDKRRQQNPPPSSQEKSLNSGA
GLSGVGGGASTNANGTHAHEGIEGMGWSDIDIRTLHRYRYAYRLSVPSSS
GGFNNTVLSTGVGRRSPARARVRIGREALATAVRKNFNAQPIQENDVIVN
FLYSVKNQDKRFRLRFPPPISKKHET

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA26YD05FM1 No hit found
SY0AAB40YO01FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00003442001 annotation :

link to GSTUMT00003442001 Artemis file
link to scaffold_172 sequence file
link to scaffold_172ESTs