Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003438001
Length(AA) : 597
Localization : scaffold_170
Number of EST contigs matching the gene: 2
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: 2-hydroxyphytanoyl-CoA lyase, putative
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001276631.1| Score: 1361 E_value: 1e-148
KEGG Definition: 2-hydroxyphytanoyl-CoA lyase, putative [EC:4.1.-.-]; K01671
Accession: afm:AFUA_8G05230 Score: 1350 E_value: 1e-147
KOG Definition: Thiamine pyrophosphate-requiring enzyme
Classification: [Amino acid transport and metabolism
Kog Number: KOG1185 Score: 1461 E_value: 1e-162
PFAM Definition: TPP_enzyme_N, Thiamine pyrophosphate enzyme, N-terminal TPP binding domain..
Pfam Number: pfam02776 Score: 413 E_value: 7e-41
Swissprot: Q9Y7M1|YGK4_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.202NO0.655NO0.179NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1490.3090.612_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=30.421First60=15.8762PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003438001
MSHQSPPVETGAQLIAHSLRSLDVRIIFGIVGIPVIEVAEACLALGIKFV
SFRNEQAASYAASAYGYLTGRPGVCLVVGGPGVLHAMAGVGNSMANATYP
LLLLAGSAETSAGPTKGAFQQLDAVSLLAPHTKFAVRPPSLEGLPQAIWD
AYRLAFYGRPGVGFVDLPADYIQGVPREVVRIQRVGEQPRVPGDERRVTA
VAEALKGAERPLVVIGKGAAYARAEGVLREFIDAAKIPFLPTPQGKGVLP
DDHPLNTSSARSAALAGADVVLLVGARLNWILHFGEPPKWSAGVRIAQID
ISPEELDHGTADPTLSIHGDIASVIAQLKTQLSNYHHVSSSWSNALSTSA
AKNLAIARVKASTPTNPLTYHRTFALIKSTLESLSPGGAENLVYVSEGAN
TMDISRSIFTVSQPRQRLDAGTYATMGVGLGYAIAAEMAYNYTHEAVPST
PSIRKRIISLEGDSALGFSLPEIETMSRYRLPIIIFVMNNGGVYHGISDN
TPTWGADWWDGDKEGKRRDVLLTSTALGFETGYDVVARGLGGRGWRVVDE
EGLVEAVREAWDHRDGPSVVNVIAASGVGEKLEFGWLGKEKGGGSKL

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3749 2-hydroxyphytanoyl-CoA lyase [Aspergillus fumigatus Af293]7e-50
Contig5627 2-hydroxyphytanoyl-CoA lyase, putative [Aspergillus clavatus NRRL 1]2e-47


Manual Annotation:

Please find below the necessary files for GSTUMT00003438001 annotation :

link to GSTUMT00003438001 Artemis file
link to scaffold_170 sequence file
link to scaffold_170ESTs