Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003410001
Length(AA) : 513
Localization : scaffold_167
Number of EST contigs matching the gene: 2
Number of ESTs : 11
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_11824
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001586795.1| Score: 1516 E_value: 1e-166
KEGG Definition: hypothetical protein
Accession: ang:An16g03090 Score: 1430 E_value: 1e-156
KOG Definition: Ribosome biogenesis protein - Nop56p/Sik1p
Classification: [RNA processing and modification
Kog Number: KOG2573 Score: 1645 E_value: 0.0
PFAM Definition: Nop, Putative snoRNA binding domain. This family consists of various Pre RNA processing ribonucleoproteins. The function of the aligned region is unknown however it may be a common RNA or snoRNA or Nop1p binding domain. Nop5p (Nop58p) from yeast is the protein component of a ribonucleoprotein protein required for pre-18s rRNA processing and is suggested to function with Nop1p in a snoRNA complex. Nop56p and Nop5p interact with Nop1p and are required for ribosome biogenesis. Prp31p is required for pre-mRNA splicing in S. cerevisiae..
Pfam Number: pfam01798 Score: 430 E_value: 7e-43
Swissprot: Q12460|SIK1_YEAST
Gene Ontology:
GO:0031428 = Cellular component: box C/D snoRNP complex
GO:0032040 = Cellular component: small subunit processome
GO:0000154 = Biological process: rRNA modification

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.067NO0.108NO0.063NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0680.1830.808_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00246First60=0.00036PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003410001
MAAVDYLLQETSVGYGLYQVVQQPDTIGNRLKEVQEATQDLSRFGKMIKL
VSFAPFQGAAQALENANDISEGIANDHLKALLELNLPKGRKKKKAVLGIS
DKNLAGSIKATFPGVDCETNEVVQDLLRGLRLWGPKLLKQLQDGDMDRAQ
LGLGHAYSRAKVKFSVQKNDNHIIQSIALLDTLDKDINTFAMRVREWYSW
HFPELVKIVNENYLYARLILFIRDKKTLSNDRLHELVAITNDDAEIAQSI
IDAAKVSMGQDISDMDIDNICNFAEKIVGARLISHAGSLTNLSKYPASTV
QILGAEKALFRALKTKGNTPKYGLIYHSSFIGRAGAKNKGRISRFLANKC
SIASRIDSFSDSPTTKFGEALRKQVEERLDFYANGTAPQKNQDAMKDAMD
AVLADIAVDADEDDGQVDLEMADIVKPKKSKDKKKEKSKENREEKSDKRQ
GKEQKEQKDKKGKKGKRDKKDKKDKKDIESKKRRRDEEEDQDVSERKKSK
KEKREKKEKKSKA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig5094 hypothetical protein SS1G_11824 [Sclerotinia sclerotiorum 1980]0.0
SY0AAB23YI16FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00003410001 annotation :

link to GSTUMT00003410001 Artemis file
link to scaffold_167 sequence file
link to scaffold_167ESTs