Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003409001
Length(AA) : 586
Localization : scaffold_167
Number of EST contigs matching the gene: 3
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001213927.1| Score: 449 E_value: 2e-42
KEGG Definition: PHD transcription factor, putative
Accession: afm:AFUA_3G12030 Score: 409 E_value: 5e-38
KOG Definition: Chromatin remodeling protein
Classification: [
Kog Number: KOG1973 Score: 124 E_value: 2e-07
PFAM Definition: HPC2, Histone promoter control 2 (HPC2). HPC2 is required for cell-cycle regulation of histone transcription. It regulates transcription of the histone genes during the S-phase of the cell cycle by repressing transcription at other cell cycle stages. HPC2 mutants display synthetic interactions with FACT complex which allows RNA Pol II to elongate through nucleosomes..
Pfam Number: pfam08729 Score: 119 E_value: 8e-07
Swissprot: O74508|SPP1_SCHPO
Gene Ontology:
GO:0000785 = Cellular component: chromatin
GO:0048188 = Cellular component: COMPASS complex
GO:0005829 = Cellular component: cytosol
GO:0006338 = Biological process: chromatin remodeling
GO:0051569 = Biological process: regulation of histone H3-K4 methylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.049NO0.100NO0.085NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4230.0150.774_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003409001
MSSLQDLLNPASSGPSSPVYARNATPPLPRQLPQTNTQEAANTLTYFANI
REHRQLSPQSNAEAAPHESSDTDTVESSSPVPPASPRRIPAGSPLRNVTA
TTTTNGYGHSSPNDRDAIGERDEDYEMGMEGGVGVSRGGVRAESERASSA
NMEILRSSPPATSASPPSTSAPTPADTTTVNTPAAGTPIATTTTMPPKSK
KNKVAKAPAPRKKGVAKLQKKKRKAVTDGDDDLEDETTPKKRQIAKKVGK
KRESEAPSGYNTETDDQDPVTRATSVKRDTTPPCPPSPSIPPSPLERYNS
AGLELYCICREPDSGKWMIACDGECDDWYHGPRCTHKGYGRTTWKRKCRL
TTCRRPADVSKRPPSKYCNDAHGVEFFDLQLDPDRTRYTSSEIKALTSAV
TSAASFRRLGDRMPTPPLSDENWKDYPEEIERLEKIAQEKVALKNRAEAN
EDRALYIDWAKDRAKRVHEEMKADPDVKHTGKEICGFDERLALDEGEWEI
WRASAEGNAVFDNHRIDGRDVCVRKKCERHANWRSIFADESQLQGRLVSE
RLVQLKHEERKIKDRQKKRSIRDSREGVVETGPWLC

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1644 hypothetical protein SNOG_14703 [Phaeosphaeria nodorum SN15]1e-26
Contig2983 No hit found
Contig4236 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00003409001 annotation :

link to GSTUMT00003409001 Artemis file
link to scaffold_167 sequence file
link to scaffold_167ESTs