Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003398001
Length(AA) : 505
Localization : scaffold_167
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : TmelFRE_8  [+]

Blast Results:

Nr Definition: conserved hypothetical protein
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001209449.1| Score: 518 E_value: 2e-50
KEGG Definition: metalloreductase Fre8, putative [EC:1.16.1.-]; K05920
Accession: afm:AFUA_3G02980 Score: 458 E_value: 8e-44
KOG Definition: Ferric reductase
Classification: [
Kog Number: KOG0039 Score: 302 E_value: 4e-28
PFAM Definition: Ferric_reduct, Ferric reductase like transmembrane component. This family includes a common region in the transmembrane proteins mammalian cytochrome B-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from mouse-ear cress. This may be a family of flavocytochromes capable of moving electrons across the plasma membrane. The Frp1 protein from S. pombe is a ferric reductase component and is required for cell surface ferric reductase activity, mutants in frp1 are deficient in ferric iron uptake. Cytochrome B-245 heavy chain is a FAD-dependent dehydrogenase it is also has electron transferase activity which reduces molecular oxygen to superoxide anion, a precursor in the production of microbicidal oxidants. Mutations in the sequence of cytochrome B-245 heavy chain (gp91-phox) lead to the X-linked chronic granulomatous disease. The bacteriocidal ability of phagocytic cells is reduced and is characterised by the absence of a functional plasma membrane associated NADPH oxidase. The chronic granulomatous disease gene codes for the beta chain of cytochrome B-245 and cytochrome B-245 is missing from patients with the disease..
Pfam Number: pfam01794 Score: 169 E_value: 1e-12
Swissprot: Q75CQ8|FRE8_ASHGO
Gene Ontology:
GO:0000293 = Molecular function: ferric-chelate reductase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.233NO0.717NO0.239NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.090.3710.696_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=127.904First60=22.1427PredHel=6
Topology=(21-43,75-94,101-123,146-168,181-203,207-229)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003398001
MLWPLLYKDLNESQRELRRKSLDFIGYSVLFSQLTALVYVYIYANFLRRG
AVRRLEWRLRYRILGGKTPTRGKVQSVGAALVYWAWMGLMIWLCVKDVDH
DYIHLTRAFGMAAAASLPLNVLLGMKYSPLKLVFPNCSYEGPVNVVHQWL
GSQIYLLLTVHACLYLKFFWDTSRMKTRLLEADALCGVWAFGVMTILVTS
AYPLVRESFYSVFYNLHIIISGLLPPLLYFHVSHSRPYIIATVGMLIVDR
VLRVMSTMSTTATISLDPRSSILDILVSFPNKPPPPAGSHILLNVPSLSL
WAKNPFTVVESGSGHVRMAARVRGNFTKKLVRVAKVPVNIESGYGGHGVS
RELVGGVDRALLIAGGIGGTFALPWARFLKANGVDARFLWVVPKVGDLLW
ARDGVALAEVYITGGHNGNGEGRDEEGMELLDASSSRDALSAHPLSLSSG
RPDIREAVGELVGRDKRALVMVCGPDLMAEDVKNAVRSHVLAGRDVTCHM
EVFGH

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig3725 hypothetical protein CHGG_09662 [Chaetomium globosum CBS 148.51]2e-12
SY0AAA9YN10FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00003398001 annotation :

link to GSTUMT00003398001 Artemis file
link to scaffold_167 sequence file
link to scaffold_167ESTs