Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003349001
Length(AA) : 142
Localization : scaffold_168
Number of EST contigs matching the gene: 2
Number of ESTs : 17
  User annotation : No user annotation

Blast Results:

Nr Definition: mitochondrial import receptor subunit tom-22
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001560841.1| Score: 246 E_value: 7e-20
KEGG Definition: predicted protein
Accession: aor:AO090001000378 Score: 219 E_value: 5e-17
KOG Definition: Translocase of outer mitochondrial membrane complex
Classification: [
Kog Number: KOG4111 Score: 199 E_value: 6e-17
PFAM Definition: Tom22, Mitochondrial import receptor subunit Tom22. The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded preproteins into mitochondria, is very complex with at least 19 components. These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family represents the Tom22 proteins..
Pfam Number: pfam04281 Score: 341 E_value: 2e-33
Swissprot: Q07335|TOM22_NEUCR

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.014NO0.026NO0.019NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1210.0530.922_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=11.2446First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003349001
MVELREVEDEHFVHSQPAHSDDEDYTDTDSEISEEDEDDDVDLEESFYER
IAALKDMIPLKQRTYISNGFSRTYNFFSKGFALGGKTLWILSTSALVLGV
PFSVAITDEQQVAEMEKEMKMTQIATDALTPGAESVLTTPQK

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1195 mitochondrial import receptor subunit tom-22 [Botryotinia fuckeliana B05.10]2e-19
SY0AAC61YC07FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00003349001 annotation :

link to GSTUMT00003349001 Artemis file
link to scaffold_168 sequence file
link to scaffold_168ESTs