Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003206001
Length(AA) : 906
Localization : scaffold_162
Number of EST contigs matching the gene: 4
Number of ESTs : 6
  User annotation : TmelMLH3  [+]

Blast Results:

Nr Definition: hypothetical protein CIMG_04094
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001244653.1| Score: 869 E_value: 7e-91
KEGG Definition: hypothetical protein
Accession: ang:An04g00870 Score: 796 E_value: 1e-82
KOG Definition: DNA mismatch repair protein - MLH3 family
Classification: [Replication
Kog Number: KOG1977 Score: 264 E_value: 2e-23
PFAM Definition: MutL_C, MutL C terminal dimerisation domain. MutL and MutS are key components of the DNA repair machinery that corrects replication errors. MutS recognises mispaired or unpaired bases in a DNA duplex and in the presence of ATP, recruits MutL to form a DNA signaling complex for repair. The N terminal region of MutL contains the ATPase domain and the C terminal is involved in dimerisation..
Pfam Number: pfam08676 Score: 120 E_value: 1e-06
Swissprot: Q12083|MLH3_YEAST
Gene Ontology:
GO:0032390 = Cellular component: MutLbeta complex
GO:0005515 = Molecular function: protein binding
GO:0007131 = Biological process: meiotic recombination
GO:0006298 = Biological process: mismatch repair

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.244NO0.473NO0.235NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3550.040.539_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00065First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003206001
MSTTAPPIRLLPESVSARIRSTLTITNISDVISELLQNAIDAGARNVAIA
VNLGRNSCVLEDDGHGVTPEGMLLVGREHATSKYPPAGDFGFRGQALSAI
CRHSLTTITSRADASGRTVMRRVSYGRELFTGAAPEHLELRRSGTVVRVE
GLWGDMPVRVKVREGVDVDKEWDDTKRGIVMVLLSRGGVGVVVKDENGEV
KVRVRVVVGSGWEVKVLKQVYAVGIDGWEKVVARMGGIGIEGRICTRGSA
SKGFQYFTEDINGYPVPMGTTLLHEEINRLFAASSFGVVEEDDGTKRLRG
NPKKGADRWAMFVLRVECQRREVDVIGGEGGTKGKAGLEGDNLSATIGLL
QRLIHEFLRTHYFRSTLATATKPQRGEGTTIRASPQSALDLLGESRPRTP
LGVLRRNTNTASSQTKDTGKLTKSRDLGVLASWSRVKSARADPREEEGRQ
GPGFSKALTFSPAPLPAGSRLTPEKGRGGDSVDDSEAPSDTCFEWRDPVS
QKTYTVNSRTGNTMTAKGPTSGRSIVRVGVKRPSSRDSFLGRRLGDDGNI
SKRACTEPLSEPKEPPGPFIESLLRTWENPVFKPTDAPIPQITLHTSEFV
PGCAHPTTNSPLFLSTWTLGKLTKTGLRNAEVISQVDKKYILIKMAGITT
SSSPDPSGLLVMVDQHAADERVRVEALFAELCSLEESPQGDQTRAQSGNL
TYKISHREAELFTRHRASFSEWKIHYTIATNGGKEKEGAKENTLTITSLP
RMVSDRCASEPSLMIDILRRHIPVLEDTTAMAHVGSASTASSLDPHAPLL
SRCPTALVDMINSRACRSAIMFNDPLELDECRLLIGKLAECKFPFQCAHG
RPSMIPLLDLGGVGTESGVGKVVTFEEGVKGKGGGFRKDFGRWVEREKER
VQRRDD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4174 hypothetical protein AN4365.2 [Aspergillus nidulans FGSC A4]3e-19
SY0AAA25YE05RM1 predicted protein [Aspergillus terreus NIH2624]8e-06
SY0AAA57YO19FM1 hypothetical protein CIMG_04094 [Coccidioides immitis RS]1e-22
SY0AAC11YN22FM1 hypothetical protein FG01614.1 [Gibberella zeae PH-1]2e-09


Manual Annotation:

Please find below the necessary files for GSTUMT00003206001 annotation :

link to GSTUMT00003206001 Artemis file
link to scaffold_162 sequence file
link to scaffold_162ESTs