Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003198001
Length(AA) : 765
Localization : scaffold_162
Number of EST contigs matching the gene: 3
Number of ESTs : 16
  User annotation : No user annotation

Blast Results:

Nr Definition: IdgA domain protein
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001275252.1| Score: 1204 E_value: 1e-130
KEGG Definition: predicted carbohydrate kinase, contains PfkB domain
Accession: aor:AO090001000699 Score: 1175 E_value: 1e-126
KOG Definition: Predicted carbohydrate kinase
Classification: [
Kog Number: KOG3009 Score: 859 E_value: 2e-92
PFAM Definition: Indigoidine_A, Indigoidine synthase A like protein. Indigoidine is a blue pigment synthesised by Erwinia chrysanthemi implicated in pathogenicity and protection from oxidative stress. IdgA is involved in indigoidine biosynthesis, but its specific function is unknown..
Pfam Number: pfam04227 Score: 889 E_value: 6e-96
Swissprot: P33025|YEIN_ECOLI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.243NO0.532NO0.189NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8210.030.17M227

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.01095First60=0.00015PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003198001
MSPVSRLPRHFPRIHPILPASCNPRSYSKAPKLNKFVQISEEVRGALTSK
TPVVALETAIYTHGFPYPDNVDLAIKVEAAIREGGAVPATIGILDGIARV
GFSQPELECLASTAGQKTTVKVSRRDLPFVVGMRHKTAYNGGTTIAGTML
LAHMAGIKVFATGGLGGVHRGYPNPMDVSADLMELGRTNVAVISAGSKAF
LDLENTFEVLETQGVFVGTFGRAGTKVMVPAFYSRESHIISPNILESPGD
AAGLTMTPDASHAMGLSSGQLFCNPIPEESEIPEKDINKVISEAVEKARH
EGVFGKDQTPYILNEIKEVTKGASLPANIALVLNNARMGTQVAQELVRFE
KGEEGPLPSVASTSNFIPPVTPPPALPPTAVDQSPTTITVPEILVIGSLA
IDQTLKTTTKLPQLHTSNPVATTETLGGVGKNVALAAHLAGANARLVSAV
GKDLAGTWALERLQALGMDISGVKKIDGGVTARYVAINNSSGELFVAGAD
MRVFESAEMGTLARGAIAKGVKVVCVDGNLSVEGLAGVVRAAAGLDIPLA
FEPTSPSKSTRILSPTLPIYPSTSTVSLTTPNTHELTAMFAHAREIGMFE
REDWWRVVCDINIDSIYFNTQLPTRLSTNLLEGGIIQSAVHLSPYFSGIM
VKLGVDGVVLVQLLPLATSFTSAALPPGTIASQGAGSVAGVMVRHFPAEV
ISQENIISVNGVGDTYLGVVLAGLVKMGMNGAHIEEVIGRAQKAAGLTLM
SPESVSGRVVEVGWR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1167 hypothetical protein CIMG_01015 [Coccidioides immitis RS]7e-53
Contig6945 hypothetical protein CIMG_01015 [Coccidioides immitis RS]1e-85
SY0AAD49YJ15FM1 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00003198001 annotation :

link to GSTUMT00003198001 Artemis file
link to scaffold_162 sequence file
link to scaffold_162ESTs