Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003197001
Length(AA) : 653
Localization : scaffold_162
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_05263
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001245822.1| Score: 1269 E_value: 1e-137
KEGG Definition: hypothetical protein
Accession: fgr:FG09790.1 Score: 1237 E_value: 1e-134
KOG Definition: ATP-dependent RNA helicase
Classification: [RNA processing and modification].
Kog Number: KOG0331 Score: 141 E_value: 3e-09
PFAM Definition: DEAD, DEAD/DEAH box helicase. Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolism, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression..
Pfam Number: pfam00270 Score: 180 E_value: 9e-14
Swissprot: Q06683|IRC3_YEAST
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.380NO0.790NO0.279NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.9210.0440.061M112

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.3111First60=0.06098PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003197001
MRRALQCTRAFSNLFLPSLYRPTPSSLPTFALSWLPQRAWNSESIKLRDY
QEDCVRAILTSMNEGERRMAISLATGGGKTVIFTELISRLTHPARPEAEK
TLILVHRRELVHQAAKQCEKQYPEKVIAIEMGTSHANVGADIIIASVQSI
INRLEKYDAELYKLILIDECHHAVSPSYLKVLTHFQAMDVNERTPIVVGV
SATVSRFDGVSLGKVMDKLVFHMWVFLKRRLSPPRFTTVSSSVDLEGVKD
RNGDFDIKGLGRAVNTDTANDIIIQTWKDRASERKSTLVFCVDIAHVRSV
MDKFRKNGINAREVTSRTLIQTRRECLEEFKAGKFPVLVNCGVFTEGTDI
PNIDCVILARPTRSKNLITQMIGRGLRKSEGTGKTDCHIIDMVANLSRGI
ATAPTLFGLDPDMIISEMTPDQMRAEAAKKAEARQKAEEKEKRLLLAVTP
PPPPIQLEYTDYDSIWDLLSDSRADQVIYTMSKLAWVSIYPGKYVLSCAR
NGYITVERDHSGWYKVEEFRALPPEMGLRGWARPKLVMSGIEHLDAVIRG
ADTYTLNTYPRKLVARSSEWRKLPATDQQLEFLKKYRHDKDWEDMRKAGT
LTKGKVGDIITRVKHGTVRRFEEGRKEQRRKERAEAKERKRRQREEVKLG
SLE

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA54YG10FM1 hypothetical protein CIMG_05263 [Coccidioides immitis RS]2e-06
SY0AAB41YI22FM1 unnamed protein product [Aspergillus oryzae]2e-15


Manual Annotation:

Please find below the necessary files for GSTUMT00003197001 annotation :

link to GSTUMT00003197001 Artemis file
link to scaffold_162 sequence file
link to scaffold_162ESTs