Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003195001
Length(AA) : 304
Localization : scaffold_162
Number of EST contigs matching the gene: 1
Number of ESTs : 8
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein An01g12310
Specie: [Aspergillus niger]
Accession: ref|XP_001389637.1| Score: 821 E_value: 6e-86
KEGG Definition: hypothetical protein
Accession: ang:An01g12310 Score: 821 E_value: 3e-86
KOG Definition: No Hit Found
PFAM Definition: Dioxygenase_C, Dioxygenase..
Pfam Number: pfam00775 Score: 431 E_value: 2e-43
Swissprot: Q5PXQ6|CHQB_NOCSI
Gene Ontology:
GO:0018581 = Molecular function: hydroxyquinol 1
2-dioxygenase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.028NO0.061NO0.024NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0520.0960.938_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00096First60=0.00007PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003195001
MDSTEENITASTVAMGSQCKDERLQYLMERLVTHLHDFARETQLTTQEWM
KALIFLKDALSPPHPLPISNVLGLSTLVDSINNPKSANATESSVLGPFYT
DNAHFTENGASIASQNRGEPCLVRCTLKDTSGNPIPDATIDVWEADETGR
YDTQYEDAAGPDCRGVLKSNEDGEFWFKCVKPVSYPIPHDGPVGELLGVL
GRHPFRPAHLHFKIEKEGFDQLITHLPPALYLRGDPYETSDAVLGVKSSL
LVTPQKVQDPEIAARYGISVSDWDILWDFVLVGEAEGRQLKKDRSGKTGY
TVSS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1042 hypothetical protein An01g12310 [Aspergillus niger]9e-99


Manual Annotation:

Please find below the necessary files for GSTUMT00003195001 annotation :

link to GSTUMT00003195001 Artemis file
link to scaffold_162 sequence file
link to scaffold_162ESTs