Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003173001
Length(AA) : 996
Localization : scaffold_162
Number of EST contigs matching the gene: 4
Number of ESTs : 4
  User annotation : No user annotation

Blast Results:

Nr Definition: serine/threonine protein kinase Ssp1 (PMID 7628434)
Specie: [Schizosaccharomyces pombe 972h-]
Accession: ref|NP_588360.1| Score: 905 E_value: 6e-95
KEGG Definition: ssp1; hypothetical protein [EC:2.7.11.17]; K07359 calcium/calmodulin-dependent protein kinase kinase
Accession: spo:SPCC297.03 Score: 905 E_value: 3e-95
KOG Definition: Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases
Classification: [Signal transduction mechanisms].
Kog Number: KOG0585 Score: 932 E_value: 1e-101
PFAM Definition: Pkinase, Protein kinase domain..
Pfam Number: pfam00069 Score: 536 E_value: 6e-55
Swissprot: P50526|SSP1_SCHPO
Gene Ontology:
GO:0051285 = Cellular component: cell cortex of cell tip
GO:0030428 = Cellular component: cell septum
GO:0005829 = Cellular component: cytosol
GO:0030042 = Biological process: actin filament depolymerization
GO:0051519 = Biological process: activation of bipolar cell growth
GO:0030950 = Biological process: establishment and/or maintenance of actin cytoskeleton polarity
GO:0007163 = Biological process: establishment and/or maintenance of cell polarity
GO:0008104 = Biological process: protein localization
GO:0006950 = Biological process: response to stress
GO:0007165 = Biological process: signal transduction

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.046NO0.213NO0.053NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.4930.040.683_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.04055First60=0.00018PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003173001
MECHNNHLVGHSSNNTSTTTSRHASTTSMFSLANLHQPHSRNPTPPTPMS
SPGLYSPPHISPSDRTVMGPHLHPSQYRQPEHNTSVRETHLLDLDFDPIS
GRKIINHYSIIDEIGRGVHGKVKLGTDLDTGELVAIKIVERSQDRPRLGR
RGDGESEKKVRREIAILKKCCHENVVRLLEVIDDPQSKKVYLILEYVQLG
EIIWRKPGVSYVPSLTIEQARCTFRDTVLGLEYLHYHGIIHRDIKPANLL
WTQDRRVKISDFGVSFLGRPIRDYEDGCDGEEATGLEQNELELAKTAGTP
AFFAPELCHVDHNQPRPQITSAIDVWALGVTLYCLVFARCPFMADNEYQL
LRVIAKDELVIPNRRPIDVDLKDLLKRLLTKDPTRRITLREVKRHPWVLH
GIADPCAWVDETDPERMSDGNRIEVTVEDVEKAVSSAGVLNRARSAVKRA
VEWGRGLRRRASSTANVISTKDMKILAEKEREVTATRCCPSAHLGDDDGE
LRWMGSNPQWRDEDKSLLSACSAANNTASSDPVRDGGGYCGSNGESLDPN
SPRRSDSESQRLQRKCSSSLCAPSRRHAIAGNEPSGTNAGFHRTHGNLSQ
GGPTENPHISRSDTSLRAPSYGHHAGSLIGNGVRRVVRSMRSGGFHDNGD
KVKGSVSRECSPLRVRDPLAGALRGDHSFYAYGTGSLHVQIPNGRRHSYA
GIDVDGSVIDNNRLSAIDCKPRWDREISKKFASFTMKDKSCPTSPDDEVS
MEKIWERDQQKAFLRHEERNKYTSPGASNADVTPGWTKESYYHPSHESPT
PPIMMERRHRGFFDDHIQMPMNSGQQSHLVSSSSEEQFATTAGSSLTNST
SFPSVPSIVSENSSISSEFFNSRYSRKNSIAGVVHEEEFDMNYRPPTPFH
QSRLSDIRQIDSDNEHEMDDDPDDDDDSDGGFIMEVPPPKKSVRSESIAV
DKLARRPLDPIEPVPRTRRRSRSSSAALKNKKARRGRTKEKVVTGD

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB41YA10FM1 hypothetical protein BC1G_12282 [Botryotinia fuckeliana B05.10]9e-41
SY0AAD23YJ09FM1 No hit found
SY0AAD31YM24FM1 No hit found
SY0AAD49YB01FM1 hypothetical protein SNOG_04984 [Phaeosphaeria nodorum SN15]5e-41


Manual Annotation:

Please find below the necessary files for GSTUMT00003173001 annotation :

link to GSTUMT00003173001 Artemis file
link to scaffold_162 sequence file
link to scaffold_162ESTs