Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003151001
Length(AA) : 606
Localization : scaffold_161
Number of EST contigs matching the gene: 2
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_08341
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001590601.1| Score: 608 E_value: 9e-61
KEGG Definition: hypothetical protein
Accession: ncr:NCU07715.1 Score: 526 E_value: 1e-51
KOG Definition: No Hit Found
PFAM Definition: No Hit Found
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.120NO0.539NO0.111NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.7330.0490.249M330

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=22.0379First60=20.1111PredHel=1
Topology=(41-63)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003151001
MVPPLDPRDPRDLHARPWKRRSSSVSAPYFRLPRRSRRATYICWTVVVFV
LYFVLNSATQWSHVPDPRSFYSKGSNVPIQYPNLYPSLSKITGGGNRAWN
RNVLFVAGNLDAASKLAGIACEMSMYGRSNVHFALIGDSNMDMELFRELN
GITEENTDCRAIFHDARADFMDLMSVERKMLVVRTALRHLRDFMHPQVLI
MSAEHEHGWLSATITDTAKKLQMPAIELPWDAADGLRWITRLDSGSLSAW
HKPNFEIVIHADTHSGNLERLLKSLESAFYPTAHHRPKSLTVILNPSVPL
HPFTKSFLSSYSFPSPSRTFIRRPLTAPQNPLDSAKQYIESFYPDSDDTS
VLVLDSNAEVSKWYYHYLLFTTLEYKYSSYQYHDAASLFGVSLEEPPSYL
NGSSPFNVPTPPKGNQPSPFLYPVPNIRAALFFPKYWSEFHAYFSKNLLY
PHQSSTSQNDTEPEPFPLGDVAANSWIAPILDIIRARGYVMLYPAFAYES
LAIVHHEQPSYTRSPRKGKKRTVKEKPLMEKNNLLDSLPNGDLPVYNSRL
PLIDWWGRPALWDWVELDALYYRKYISNCKVEDTGLPWMVRGVDDIFCDP
NGNSLE

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAB26YN21FM1 hypothetical protein NCU07715 [Neurospora crassa OR74A]3e-09
SY0AAC49YP03FM1 hypothetical protein SNOG_13912 [Phaeosphaeria nodorum SN15]2e-16


Manual Annotation:

Please find below the necessary files for GSTUMT00003151001 annotation :

link to GSTUMT00003151001 Artemis file
link to scaffold_161 sequence file
link to scaffold_161ESTs