Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003139001
Length(AA) : 693
Localization : scaffold_161
Number of EST contigs matching the gene: 2
Number of ESTs : 3
  User annotation : TmelMLH1  [+]

Blast Results:

Nr Definition: hypothetical protein An18g03030
Specie: [Aspergillus niger]
Accession: ref|XP_001398763.1| Score: 1731 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An18g03030 Score: 1731 E_value: 0.0
KOG Definition: DNA mismatch repair protein - MLH1 family
Classification: [Replication
Kog Number: KOG1979 Score: 1676 E_value: 0.0
PFAM Definition: DNA_mis_repair, DNA mismatch repair protein, C-terminal domain. This family represents the C-terminal domain of the mutL/hexB/PMS1 family. This domain has a ribosomal S5 domain 2-like fold..
Pfam Number: pfam01119 Score: 284 E_value: 8e-26
Swissprot: Q9P7W6|MLH1_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0006298 = Biological process: mismatch repair

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.019NO0.046NO0.020NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1990.0350.87_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.04839First60=0.01297PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003139001
MDSADPRGSKRKADYADAPSPASAAPQLPRRIKPLDQVVVNKIAAGEIIV
APVHALKELIENSVDAGSTSIDILVKDGGLKLLQISDNGHGIDENDLPIL
CERFTTSKLQSFEDLQSIGTYGFRGEALASISHIAHLTITTRTANSPIGL
RATYSDSKLITPKPGQPANPKPVHRNKGTQITVEDLFYNVPSRRRAFRSP
SEEYAKILDLVGRYAVHCGGVAFSCKKYGDPDVGVSTTAGATTTDRIRRI
HGNAVANELLPFEVSDDYLGFKAKGMLSNANYHVKKTTLLLFINNRSVDS
SSIRKGIESTYAPFLPKGGHPFAYMSLDIEPHRVDVNVHPTKREVNFLHE
EEIVQKLCESLQEKLAAVDTSRSYALTQALLPSAKAVPDNSSGQKAAART
ASRAEESKQPLVAKPKKTYDYNMVRADTRDRKITTMLQPKSQKEDRTAEG
DEYEYDDNRQWTSVKYQTIKKLRKAVWDTKHKDLCELFHNHTFVGIVDEQ
RRLASVQHGLKLYLIDYAAAAFELFYQIGLSDFSNYGTIRLNPPLALKDI
LEIAIEDEKKTEGVNPDSNNEFDWEGAYKIVDTLVSRRDLLKEYFSMEIT
EQGELRAELINQILPKVDTSSDSPDNNNEGEGGGGGWRDATALAKRKDEL
NRAVETILFPTFKRRLIAPPPLLQGVTEIANLRGLYRIFERSC

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1025 hypothetical protein An18g03030 [Aspergillus niger]1e-109
SY0AAA50YH18FM1 hypothetical protein SNOG_08751 [Phaeosphaeria nodorum SN15]2e-52


Manual Annotation:

Please find below the necessary files for GSTUMT00003139001 annotation :

link to GSTUMT00003139001 Artemis file
link to scaffold_161 sequence file
link to scaffold_161ESTs