Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003138001
Length(AA) : 272
Localization : scaffold_161
Number of EST contigs matching the gene: 1
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_11482
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001550274.1| Score: 567 E_value: 2e-56
KEGG Definition: hypothetical protein
Accession: ncr:NCU07718.1 Score: 511 E_value: 2e-50
KOG Definition: No Hit Found
PFAM Definition: Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins..
Pfam Number: pfam00583 Score: 120 E_value: 3e-07
Swissprot: No Hit Found

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.164NO0.554NO0.117NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.8090.0460.181M211

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.06459First60=0.00286PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003138001
MRLSNATRVRYSYQTLCFQVCHRYPGVGMSKLATKKLGIEDCKAAADTLA
EAFFKDDVAFYFLDTPDNGGKTRDELYPLHREILEYIVAAHCYNGLVLSI
GENHEGVALWMPPGQNMDDWFTIFRSGMWRLWYKLTKEGKRRYFDEFMEI
LHRTKESVMGAQDSDTWYLVYVGVVPSARGRGYARKLIEYVTKKLDAEGG
KPCYLESSHPRNVAMYQKLGFVKQRHIVLGPDCSNPAPLDIMVRPPMDRR
RENYSSSRKMSVATGVGRVLSA

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1794 hypothetical protein BC1G_11482 [Botryotinia fuckeliana B05.10]7e-58


Manual Annotation:

Please find below the necessary files for GSTUMT00003138001 annotation :

link to GSTUMT00003138001 Artemis file
link to scaffold_161 sequence file
link to scaffold_161ESTs