Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003136001
Length(AA) : 666
Localization : scaffold_161
Number of EST contigs matching the gene: 2
Number of ESTs : 53
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_03226
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001558194.1| Score: 2359 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ncr:NCU09741.1 Score: 2303 E_value: 0.0
KOG Definition: NADP/FAD dependent oxidoreductase
Classification: [Energy production and conversion].
Kog Number: KOG1158 Score: 1211 E_value: 1e-133
PFAM Definition: FAD_binding_1, FAD binding domain. This domain is found in sulfite reductase, NADPH cytochrome P450 reductase, Nitric oxide synthase and methionine synthase reductase..
Pfam Number: pfam00667 Score: 480 E_value: 1e-48
Swissprot: Q00141|NCPR_ASPNG
Gene Ontology:
GO:0005792 = Cellular component: microsome
GO:0009055 = Molecular function: electron carrier activity
GO:0006118 = Biological process: electron transport

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.859YES0.992YES0.747YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0110.9680.111S122

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=16.0575First60=15.9856PredHel=1
Topology=(7-24)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003136001
MATQLDTLDVLVLAALLLGTIAYFTKGSLWAVEKDTITGIYGGSKANGAA
TKGSKTRDIVKTMEESDKNMVIFYGSQTGTAEDYASRLAKEGSARFGLKT
MIANLEEFDYENLDTLPEDKVAVFVMATYGEGEPTDNAVDFYEFIMGDDV
NFTEGDRLGNLKFIGFGLGNNTYEHFNAVIRRLTATLLKLGAKQIGNIGE
GDDGTGTMEEDFLAWKEPMWKALQEEMDLEEREAVYEPVFSIAERTELSV
EDDTVYLGEPNKNHLEGGSKGPYGANNPFIAPIKSSREIFTVKDRNCLHM
EIDLTGTNLSYTTGDHIAVWPTNAGKEVDGFLKVLGLEEKKDGVIDVTGI
DSTAKVPFPTPTTYDAIARYHLEICAPVSRQFLASLAAFAPTPTAKDELT
RLGGDKDYFQETISSRYLNIAQVLELNAPGEIWSNVPFSLMVEGLNRIQP
RYYSISSSSLVQPKLVSITCHGDPEPDPHGLSYAITGPRNKYDGIHVPVH
TRASNFRLPSDPSKPVIMIGPGTGVAPFRAFVQERAALAEKGERIGKTLL
FFGCRKASEDFLYQEEWKEYASKLGDSFSLITAFSRDGPEKVYVQHRLKE
RAKEVNELLAQGSYFYVCGDAAHMAREVNTSLGSIIAQERGLTETQGEEI
VKRLRSSNLYQEDVWS

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig7224 hypothetical protein BC1G_03226 [Botryotinia fuckeliana B05.10]0.0
SY0AAB42YD04FM1 hypothetical protein BC1G_03226 [Botryotinia fuckeliana B05.10]2e-41


Manual Annotation:

Please find below the necessary files for GSTUMT00003136001 annotation :

link to GSTUMT00003136001 Artemis file
link to scaffold_161 sequence file
link to scaffold_161ESTs