Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003074001
Length(AA) : 1062
Localization : scaffold_156
Number of EST contigs matching the gene: 3
Number of ESTs : 11
  User annotation : Tmelsla2  [+]

Blast Results:

Nr Definition: ANTH domain protein
Specie: [Aspergillus clavatus NRRL 1]
Accession: ref|XP_001270633.1| Score: 3212 E_value: 0.0
KEGG Definition: cytoskeleton assembly control protein Sla2, putative
Accession: afm:AFUA_3G06140 Score: 3199 E_value: 0.0
KOG Definition: Actin-binding protein SLA2/Huntingtin-interacting protein Hip1
Classification: [Cytoskeleton].
Kog Number: KOG0980 Score: 2087 E_value: 0.0
PFAM Definition: ANTH, ANTH domain. AP180 is an endocytotic accessory proteins that has been implicated in the formation of clathrin-coated pits. The domain is involved in phosphatidylinositol 4,5-bisphosphate binding and is a universal adaptor for nucleation of clathrin coats..
Pfam Number: pfam07651 Score: 673 E_value: 9e-71
Swissprot: Q9P6L5|SLA2_SCHPO
Gene Ontology:
GO:0030479 = Cellular component: actin cortical patch
GO:0051285 = Cellular component: cell cortex of cell tip
GO:0032153 = Cellular component: cell division site
GO:0005515 = Molecular function: protein binding
GO:0042815 = Biological process: bipolar cell growth
GO:0030866 = Biological process: cortical actin cytoskeleton organization and biogenesis
GO:0006897 = Biological process: endocytosis
GO:0030950 = Biological process: establishment and/or maintenance of actin cytoskeleton polarity
GO:0007163 = Biological process: establishment and/or maintenance of cell polarity
GO:0031505 = Biological process: fungal-type cell wall organization and biogenesis
GO:0008104 = Biological process: protein localization

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.034NO0.120NO0.033NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1690.060.866_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.06838First60=0.00097PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003074001
MAYTGSTRNVDMSRSESDLVINIKKATNMEETAPKRKHVRSCIVYTWDHK
SSQSFWAGMKVQPIMADEVQTFKALISIHKVLQEGHPVTIREAHAHTGWL
ESLTRGVAGEGLRGYGPLIREYIYFLLAKLAFHRHHPEFNGVFDYEEYIS
LKSINDPNEGYETITDLMTLQDQIDAFQKLVFSHFRHGVNNECRISCLVP
LVQESYGIYKFITSMLRAMHQSTGDDDALAPLRDRYDGQHHRLVRFYYEC
SNLRYLTSLITVPKLPQDPPNLLSEEDAPPALPRRPANEMPPPPEPIPSP
PAISQPEPEPISDFWSQEQLQQQRAYEEEQRRLQEQREAELRQQEMLALQ
NQRAYEEMQRQQQEQQRLAHEQLLRDQMARQAQGQAAELERQLLEYQGQL
ANNVLLLESYDQKVKALETELMNLNLNSQQQQQSKDDLIKSLQDQVAMWK
SKYEALAKLYSQLRHEHLELLGRYKQMQLKANSAQEAVERREKLEREMKS
KNLELADMIRERDRALYDLDRVKGAQKEEVEKVKRELRFAQEKADNNERS
RGSELSALLTRHNREVADLEDILRGKQRMIDELSSRSDDKHNDMEQLLRA
KEEELEIFKAGMDQTLLELSEMRHNNTETDHVLEAQIDELLLDQLKKLTE
IIDSVLQSGVQRIDDALYELESPMNAGNQSASPGYLLSQIEKAQMSATEF
ATSFNHFIADGPNSTQSQIIKTLHVFAGAIADVLANAKGVTRFAPDERRS
EAILSSARQSAGTAVKFFQNLMSFRLDDLSVDRKTDIVVSSNLEVQKHLQ
KLNKLAEQFMAKGGSDLSKASGDLGDVVDAEMNKAAAAIEAATARLAQLM
KKPKNPGYSTFEISIHDSILDAAIAVTNAIAQLIKAATVSQQEIVAQGRG
SSSRTAFYKRNNRWTEGLISAAKAVAMSTNMLIETADGVISGHKKLEQLI
VVANDVAASTAQLVAASRVKASFMSKSQERLEAASKAVTSACKSLVRQVQ
DIISAKNREENEDVDYSKLTSHEFKVQEMEQQVEILQLETQLQQARQRLG
EMRKHSYAQDQD

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1803 unnamed protein product [Aspergillus oryzae]1e-133
Contig4033 hypothetical protein MGG_02949 [Magnaporthe grisea 70-15]3e-93
Contig4483 hypothetical protein SNOG_00689 [Phaeosphaeria nodorum SN15]1e-84


Manual Annotation:

Please find below the necessary files for GSTUMT00003074001 annotation :

link to GSTUMT00003074001 Artemis file
link to scaffold_156 sequence file
link to scaffold_156ESTs