Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00003020001
Length(AA) : 432
Localization : scaffold_155
Number of EST contigs matching the gene: 1
Number of ESTs : 2
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_10325
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001588778.1| Score: 1668 E_value: 0.0
KEGG Definition: conserved hypothetical protein
Accession: mgr:MGG_08317 Score: 1597 E_value: 1e-176
KOG Definition: No Hit Found
PFAM Definition: MR_MLE, Mandelate racemase / muconate lactonizing enzyme, C-terminal domain. C-terminal domain is TIM barrel fold, dehydratase-like domain. Manganese is associated with this domain..
Pfam Number: pfam01188 Score: 172 E_value: 5e-13
Swissprot: P77215|YFAW_ECOLI

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.216NO0.523NO0.155NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.2640.1170.541_40

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=1.21752First60=0.04521PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00003020001
MSLKAFPTIKAIRSYVTQGVGSGGDYHNVASGHWRTNIYRLVDTPIANPM
SRYEQYKYSRTSWGINVLGSLFVVIEASDGTTGFATGFGGPPAAWIIHNH
LERFLVGADPRNLNLLWDQMFRATMFYGRKGLPIATISVIDLALWDLLGK
IRGEPVYKMIGGATRERLSFYCTGPEPVAAKEMGFFGAKVPLPYGPDDGH
EGLKKNIEFLKKHRESVGPDYPLMVDCYMALTVPYTIQLATATLDLNINW
WEEVLHPDDSDGFEKLKQALPQLKFTTGEHEYTRYGFRKLIEGRNIDILQ
PDVTWVGGLTELLKVTAQAAAYDLPVIPHASGPYSYHYVVSQPNCPFQEY
LANSPDGKSVYPVFGDLFIDEPIPTNGWIDVSVLDKPGFGLTLNPKARLI
EASRLLNPAPVKSLKAPEVEKEAPTVSGAPGR

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1543 No hit found


Manual Annotation:

Please find below the necessary files for GSTUMT00003020001 annotation :

link to GSTUMT00003020001 Artemis file
link to scaffold_155 sequence file
link to scaffold_155ESTs