Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002953001
Length(AA) : 691
Localization : scaffold_149
Number of EST contigs matching the gene: 1
Number of ESTs : 3
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein ATEG_06734
Specie: [Aspergillus terreus NIH2624]
Accession: ref|XP_001215912.1| Score: 2247 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: ang:An11g09350 Score: 2246 E_value: 0.0
KOG Definition: NADH-dehydrogenase (ubiquinone)
Classification: [Energy production and conversion].
Kog Number: KOG2495 Score: 809 E_value: 1e-86
PFAM Definition: Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain..
Pfam Number: pfam07992 Score: 291 E_value: 1e-26
Swissprot: Q07500|NDH2_YEAST
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion
GO:0019655 = Biological process: glucose catabolic process to ethanol
GO:0006116 = Biological process: NADH oxidation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.108NO0.245NO0.076NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.9160.0230.124M263

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=41.0009First60=0PredHel=1
Topology=(84-106)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002953001
MLRQRVLSSFHTNPLTRQIFKPSPLLRTLQKLNTRRASPSPLSNASLRTI
PARSSPLPTPHSRASATIAPSNGSKTPKRSKVVRFVYKASAFCGFAGLTA
TGLVVAFFIYDASTYKEEAEKYDIGVSELALNPRRGGPKNLPIAEVLVDD
EDGEEMLKQRDKPRLVVLGCGWGSVSLLKNINPDNYHITVVSPSNYFLYT
PLLPSATVGTLELRSLVEPIRRITSRVKGHFLKANAEGVDFSAKLVEVSQ
TLPSGEVRRFYLPYDKLVIGVGSKTRTHGVEGLENVEFLKNVADARKIRS
KVIECFERACLPSTTDEERRKLLSFVICGGGPTGVEFAAELFDMLNEDLT
LVYPKILRNEVSVHVVQSRSHILNTYDEALSRYAEERFARDQVDVLTNAR
VSRIENDRVIFTQKEKGSGKVITKELPFGMCLWSTGVAQTDFAEHIASQL
ELQRNKHALETDSHLRLLGTPLGDVYAIGDCSTVQNNIASHITHFLRQIA
WEKGADPEKLALDFGMWRNVATRVRKKFPQATDHLRRLDRLFEQYDVDKS
GTLDFDELKELLSQIDSKLTSLPATAQRAHQQGQYLARKFNKLAQAAPGL
AVNNVTDGDLDEAVYKGFEYKHFGSLAYIGNAAVFDLNGLSIGGGLIFVY
LWRSVYFAQSVSLRTRMLLAMDWGKRALFGRGEIKFPFLCV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig4453 NADH-ubiquinone oxidoreductase 64 kDa subunit, putative [Aspergillus clavatus NRRL 1]1e-101


Manual Annotation:

Please find below the necessary files for GSTUMT00002953001 annotation :

link to GSTUMT00002953001 Artemis file
link to scaffold_149 sequence file
link to scaffold_149ESTs