Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002941001
Length(AA) : 314
Localization : scaffold_149
Number of EST contigs matching the gene: 2
Number of ESTs : 7
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_07564
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001590940.1| Score: 847 E_value: 7e-89
KEGG Definition: hypothetical protein
Accession: ani:AN0719.2 Score: 817 E_value: 1e-85
KOG Definition: Histone acetyltransferase PCAF/SAGA
Classification: [
Kog Number: KOG3902 Score: 794 E_value: 2e-85
PFAM Definition: TFIID-18kDa, Transcription initiation factor IID, 18kD subunit. This family includes the Spt3 yeast transcription factors and the 18kD subunit from human transcription initiation factor IID (TFIID-18). Determination of the crystal structure reveals an atypical histone fold.
Pfam Number: pfam02269 Score: 286 E_value: 2e-26
Swissprot: O14311|SPT3_SCHPO
Gene Ontology:
GO:0005829 = Cellular component: cytosol
GO:0005634 = Cellular component: nucleus
GO:0006367 = Biological process: transcription initiation from RNA polymerase II promoter

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.037NO0.091NO0.034NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.070.1430.863_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00017First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002941001
MSNDKFKYRVEIQQMMFVSGETGEPSAETTGIIEEIVRGQVIEMLQQCTN
LASRRGSRSISTDDLIFLIRHDKAKVSRLRTYLSWKDVRKTAKDNDPSGG
AGAPDPADLLDDAAAGIAGGTGPVQMRQKKAKIGLPWEVASFFSEQVPER
EEDEDEDEVEANAATLQRLKNADERTRGMTRDEYVHWSECRQASFTFRKG
KRFREWAGFGTVTDAKPNDDIVDILGFLTFEIVQTLTEEALKVKELEDQV
LLESREKSKKRKREKFLFHAEEGRTPIEPRHVEEAFRRLQVPKPKSRAMR
NFSGGVVKSKLTLV

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1421 spt3 [Ajellomyces capsulatus NAm1]3e-53
Contig5124 hypothetical protein SS1G_07564 [Sclerotinia sclerotiorum 1980]6e-39


Manual Annotation:

Please find below the necessary files for GSTUMT00002941001 annotation :

link to GSTUMT00002941001 Artemis file
link to scaffold_149 sequence file
link to scaffold_149ESTs