Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00002939001
Length(AA) : 149
Localization : scaffold_149
Number of EST contigs matching the gene: 1
Number of ESTs : 34
  User annotation : MANTUM00002939001  [+]

Blast Results:

Nr Definition: hypothetical protein CC1G_09155
Specie: [Coprinopsis cinerea okayama7#130]
Accession: gb|EAU81969.1| Score: 367 E_value: 7e-34
KEGG Definition: hypothetical protein
Accession: ani:AN6273.2 Score: 330 E_value: 6e-30
KOG Definition: No Hit Found
PFAM Definition: Cerato-platanin, Cerato-platanin. This family contains a number of fungal cerato-platanin phytotoxic proteins approximately 150 residues long. Cerato-platanin contains four cysteine residues that form two disulphide bonds..
Pfam Number: pfam07249 Score: 342 E_value: 2e-33
Swissprot: Q1E8D2|AG19_COCIM

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.971YES0.996YES0.876YESY

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0360.9520.038S119

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.88492First60=0.83768PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00002939001
MQFLKTILLLASTLTLTLAQSAGVAKYDTTYDSASLSTLSVACSDGANGL
YTKGYHTLGSVPGFPNLGGSGTIPGWNSPNCGACYELTYTPPAPAAPKVL
NIVGVDVAAPGTFVLSRTALDTLTGGQAVPLGRVNVTWRPVAASVCGFP

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1532 hypothetical protein CC1G_09155 [Coprinopsis cinerea okayama7#130]4e-33


Manual Annotation:

Please find below the necessary files for GSTUMT00002939001 annotation :

link to GSTUMT00002939001 Artemis file
link to scaffold_149 sequence file
link to scaffold_149ESTs